SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul R    

ID / Description / Sequence
1 >lcl|XP_001082251.1|Plus132018..34027 NW_001106377 protein fem-1 homolog A-like isoform 2 FEM1A __SEG__ Chr19 {Macaca mulatta} MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAARYGHLDVVEYLVDRCGASVEAGGSVHFDGETIEGAPPLWAASAAGHLDVVRSLLRRGASVN
RTTRTNSTPLRAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCKARMERDGYGMTPLL
AASVTGHTNIVEYLIQEQPGQEQIAGGEAQPGLPQEGPSTSQGCAQPQGAPCCSSSPEEPLNGESYESCCPTSREAAVEALELLGATYVDKKRDLLGALKHWRRAMELRH
QGGEYLPKPEPPQLVLAYDYSREVNTTEELEALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQQTNLEPLSPMTASSFLSFAE
LFSYVLQDRAAKGSLGTQIGFADLMGVLTKGVREVERALQLPREPGDSAQFTKALAIILHLLYLLEKVECTPSQEHLKHQTVYRLLKCAPRGKNGFTPLHMAVDKDTTNV
GRYPVGRFPSLHVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPAIMNALIEAGAHMDATNAFKKTAYELLDEKLLARGTMQPFNYVTLQCLAARALDKNKIPYKGFIPE
DLEAFIELH*
2 >lcl|XP_001082451.2|Plus1659697..660251 NW_001120954 ras-related protein Rap-1b RAP1B __SEG__ Chr6 {Macaca mulatta} MREYKLVVLASGGVGKSALTVQFVQGICVEKYDPTIEDSYRKQVEADAQQCMLEILDTAGREQFTAMRDLYMKNGQGFALVYSVTAQSTFNDL*DLRENRFFELKTLMMF
Q*FLLVISVTWKMKEL*GRNKVKI*QDNGTTVHSYNLLQNQKEMLMRSFMI*CGKLTENLQCLGRLAKSHHVSCF
3 >lcl|XP_001082979.2|Plus1327454..328401 NW_001218177 ankyrin repeat domain-containing protein 58-like LOC694278 __SEG__ ChrX {Macaca mulatta} MAQPGGATNRAPTASLAPTAQSLRCAPQPRPSRADTGSLGRYWGKAAATASREPPFPGTLMHSGAGSGRRRVALRELLGLQRAAPAGWLSEERAEELGGPSGPGSSRLCL
EPREHAWILAAAEGRYEVLRELLEAEPELLLRGDPITGYSVLHWLAKHGRHEELILVHDFALRRGLRLDVSAPGSGGLTPLHLAALQGHDMVIKVLVGALGADATRRDHS
GHRACHYLRPDAPWRLRELSGAEEWEMESGSGCTNLNNNSSGTTAWRAASAVGATAVETSRRAAASRTKAKDTAGSRVAQMHVLFRHLFPSFQDR*
4 >lcl|XP_001083007.1|Plus1complement(302911..304677) NW_001101662 calicin CCIN __SEG__ Chr15 {Macaca mulatta} MKLEFTEKNYNSFVLQNLNRQRKRKEYWDMALSVDHHVFFAHRNVLAAVSPLVRSLISSNDMKTTDELFITIDSSYLSPVTVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRVHCNDFLIKSIRRANCLRYLFLAELFELKEVSDLAYSGIRDNFHYWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSALINWVYFRKEEREKYFKKFF
NYINLNAVSNKTLVFASNKLVGMENSSSHATLIENVLMDRKQERPCSLLVYQRKGALLDSVVILGGQKAHGQFNDGVFAYIIQENLWMKLSDMPYRAAALSATSAGRYIY
ISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEVWCLAGKMSIPMDGTAVITKGDRHLYIVTGRCLVKGYIS
RVGVVDCFDTSTGDVVQCITFPIEFNHRPLLSFQQDNILCVHSHRQSVEINLQKVKASKTTTSVPLLPNNCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA
FLLDQKTGEWKTLAAPPEALDCPACCLAKLPCKILQRI*
5 >lcl|XP_001083092.1|Plus1633332..633709 NW_001124216 zinc finger RNA-binding protein-like LOC694402 __SEG__ Chr9 {Macaca mulatta} MALLVEKAISSASSPQGPRDALRRVFESISSGIIFKSSPGLLDLCEKDPFDTLATMTDQQREDITSSAQFAFRLLAFRQIYKVIDMDPLSQMSQHFNIHNNRKRKRDSDG
VDGFEAERKKKEKRL*
6 >lcl|XP_001083861.1|Plus1complement(29106..30293) NW_001122911 DDB1 and CUL4 associated factor 4-like 2 DCAF4L2 __SEG__ Chr8 {Macaca mulatta} MENKRPRLLEEADKQKKIARVGLNAPSMLRKNQLGFLRFANYCRLARELRVSCMQRKKVQIHSWDPSSLASDRFNRILANTNTDQLFTVNQVEAGGSKYGIITMRGLTTP
ELRVYPHKSLYVPNRKVNSMCWASLNHLDSHLLLCFVGLADTPSCAVLLPASLFIGSYPGMRRPGMLCSFQIPDAWSCAWSLNIHAYHCFSTGLSQQVLLTNVVTGHQQS
FGTSSDVLAQQFAIMTPLLFNGCRSGEVFGIDLRCGNQGRGWKAICLSHDSAVTSLQILQEGQCLVASDMTGTIKLWDLRATKCVTQYEGHVNNSAYLPLHVNEEEGVVA
AVGQDCYTRIWSLRHGHLLTTIPSPYPASEDDIPSVAFSSRLGGFRGAPGLLMAVREDLYCFSYG*
7 >lcl|XP_001084135.1|Plus1complement(234930..236339) NW_001095109 uncharacterized protein C20orf135-like LOC695048 __SEG__ Chr10 {Macaca mulatta} MCVICFVKALVHVFKIYLTASYTYTFRGWPVAFRWDDVRAAGGSSSHRALTCAAAAAGVWLLRDEALGGDALGRPPRGVRSQAQCLLQQLRELPGQLASYALAHSLGRWL
VYPGSVSLMTRALLPLLQQGQERLVERYHGRRAKLVACDGNEIDTMFMDRRQDPGSHGHGLRLVICCEGNAGFYEMGCLSAPLEAGYSVLGWNHPGFGGSTGVPFPQHDA
NAMDVVVQYALHRLHFSPAHVVVYGWSVGGFTATWATMTYPGLGALVLDATFDDLVPLALKVMPHSWKGLVVRTVRQHFNLNVAEQLCCYPGPVLLLRRTQDDVVSTSGR
LRPLSPGGVEGNRGNELLLRLLEHRYPAVMAPEGRAVVIRWLRAGSLAQEAAFYARYRVDEEWCLALLRSYRARCEEELEGEEAQGPHGPAFPWLVGQGLSSRRRRRLAL
FLARKHLKNVEATHFSPLEPEEFQLPWGL*
8 >lcl|XP_001084522.1|Plus12391740..2392579 NW_001106494 pleckstrin homology domain-containing family F member 1-like LOC700343 __SEG__ Chr19 {Macaca mulatta} MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFV
VSAASATERQEWISHIEECVRRQLRATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRQRFLLPRLSPKPVRVCSLCYRELAAQQRQEEA
EEQGAGSPGQPAHLTRPICGASSGDDDDSDEDKEGSRDGDWPSRVEFYGSGVAWSAFHS*
9 >lcl|XP_001085169.1|Plus146078..48096 NW_001218178 transcriptional regulator Kaiso isoform 1 ZBTB33 __SEG__ ChrX {Macaca mulatta} MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGV
KFIAELGVPLSQVKSISGTAQDGNTEPLPPDSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEMKKIIVTDSDDDDDDVIFCSEILPTKETLPSNNTVAQVQSN
PGPVAISDVAPSASNNSPPLTNITPTQKLPTPVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLSTPPNVSSSLPNHIPSSINLLVQNQQTPNSAILTGNKANEEE
EEEIIDDDDDTISSSPDSAVSNTSLVPQADTSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGLGSKHLMEGQKIITLDTATEIEGLSTGCKVYANIGED
TYDIVIPVKDDPDEGEARLENEIPKTSGSEMANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRY
QCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTMPAMKGDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDG
STEFEFIIPESY*
10 >lcl|XP_001085454.1|Plus1complement(6928622..6929599) NW_001104501 BTB/POZ domain-containing protein KCTD12 KCTD12 __SEG__ Chr17 {Macaca mulatta} MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPER
SRLQREAEYFELPELVRRLGAPQQPGPGPPPSRRGVHKEGSLGDELLPLGYAEPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSYTI
GRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE*
11 >lcl|XP_001085880.1|Plus1complement(9681..>10208) NW_001106390 arrestin domain-containing protein 5-like LOC697277 __SEG__ Chr19 {Macaca mulatta} NPLLVEAEEKVSYNCCRQGTICLQIQMEKNTFTPGEKVVFTTEINNQTSKCIKTVIFALYAHVRYEGFTPGAERRSRLDSSELLRQEANTHMTRFNTTKIVSTFSLPVLL
SVSSSTRDGEIMHTRYELVITVHLPWSLTSLKAKVPIIITSASVDSAGCQSSEDGVLPVSPDHQN*
12 >lcl|XP_001086668.1|Plus1complement(482398..484329) NW_001218100 kelch-like protein 34 KLHL34 __SEG__ ChrX {Macaca mulatta} MSYFLSYCKAHGGALLTGYQALRAEGFLCDVTLETEGSEFPAHRSLLACSSDYFRALFKSHTQESRARVIHLHVPSAAGLQRLLDFIYTAWLSLSMDTVEDTLEAASYLQ
VTEALGLCGRYLERQLAPENCCFAANVASRFGLAHTLDAAERCIVRHLRELLARGAGPAGLLELNPTSLRAVLGAPDVARVPEARLLGLALAWLRQEPTTERLAHCTELL
EHVRFGLVPADVLRRVYSGSGLVLPARVKGLIIQALNYHTTPSRQPLMQGEQTSIRSPQTRILLVGGRRAREVVIEEVVAPQRAARGRVAAPEPEEEEEELEEEEEEEWE
LTQNVVAFDVYNHRWRSLTQLPTPLLGHSVCTAGNFLFVLGGESPSGSVTSTLADSPRVVTAEVHRYDPRFHAWMEVPAMQEARAHFWCGAVGGRLLAVGGLGAGGEALA
SVEMYDLRRDRWTAAGALPRALHGHAGAVGDRGVVYISGGKAGRGEGGASSLRDLYVLGPEEQAWSKRAPMGTARFGHHMAVLRGAVFAFLGRYEPFSEIERYDPGADQW
TRLRPLPYDRFCYGLAVVEETALLLGGLKWRDSRQVPTRNVVGYDLDLDRWEDIGCALPWAWSGLQCAVLQLADGGDEEREGEPGEALDLVLG*
13 >lcl|XP_001086777.1|Plus1complement(720859..722628) NW_001121190 ectoderm-neural cortex protein 2-like isoform 1 KLHL25 __SEG__ Chr7 {Macaca mulatta} MSVSVHETRKSRSSTGSMNVTLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
AINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKH
DLEPRKAHLPELLRSVRLALLPSDCLQEAVSSEALLMADERTKLIIDEALRCKTRILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSASAIGCKVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPGANKWMMVAPLRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCYDPAENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA*
14 >lcl|XP_001087200.1|Plus1complement(161857..163128) NW_001101634 torsin family protein C9orf167 C15H9orf167 __SEG__ Chr15 {Macaca mulatta} MDRGQPSLEPAAAAPQATGRCMIAPVRAVLRLRRRVCVLRKRRLLQLGGGPDVGTGVPRPGCSPPAPRGDLDQPQFFTFDGPAELPSRTPRKKRRRSRLVLYPETSRKYR
PRVEHRSRAQHCLLLLVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRAVFGQPAAIARIVALMRDYLATHVHSRPLLLALHGPSGVGKSHVGRLLARHFRSVLEDSSL
VLQYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELLPRPLLDELHGFLQPQRSHHFHNAIYVLLSGAGGAEVTRFVLQNASRALPLLPDGARSAE
ASAAQAEEDLRTSLWALLSREHPLWQAAAIVPFLLLDKRDVVSCFRDEMAGEGFFPDQARAEDLAAQLSFYRVAGREFAVTGCKQVVATVNLL*
15 >lcl|XP_001087647.1|Plus1complement(143400..144323) NW_001218171 mitochondrial carrier triple repeat protein 6-like MCART2 __SEG__ ChrX {Macaca mulatta} MGEQNHSPGKELQPRTRAEAPGKKSWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAMAVSEAVRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVG
PHTLGHRWAAGLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSV
NGTITCLVLYPLIVLVANMQSHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSHSRKELKTD*
16 >lcl|XP_001088535.1|Plus1complement(545173..546075) NW_001218113 homeobox protein NANOG-like LOC701858 __SEG__ ChrX {Macaca mulatta} MSMDPAYPQSLPCSEASNCKESSLTPVTCGPEENYPSLQMSSAEMPHAETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSTAKKEDKVPVKKQKTRTVFSSTQLYIL
NDRFQRQKYLSLQQMQELSAILNLSYKQVKTWFQNQRMKSKRRQKNNWPKNSSGVTQKASAPTYPTLYSSYHQGCLVNTTGNLSMWSNQTCSNSAWSNQTQNVHSWSNHS
WCTQSWNNQAWNSPFSNCGEESLQSCMQFQPNSPASYLEVALETAGESHNVIQQTTRYFSTPQAIDLFLNDSTNMQPEDT*
17 >lcl|XP_001089430.1|Plus1760809..761447 NW_001121162 sentrin-specific protease 8-like LOC697613 __SEG__ Chr7 {Macaca mulatta} MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDDVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLR
DKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPTYITKKRGEWKDLIATLAKK*
18 >lcl|XP_001089460.2|Plus1complement(3320..3934) NW_001116521 sterile alpha motif domain-containing protein 5-like LOC701153 __SEG__ Chr4 {Macaca mulatta} MCTNIVYEWLKALKLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILDAVRRLREQDADAAGLYFTLEPQPAPPGQPADTVPTGRRGEPYGGPAQGTRGDS
RGHTVAPRSRELVSYPKLKLKIMIRDKLVRDGIHLSKPPYSRKVRRCRPGGLGRAAGGDRTQLPVPRLCTPFQVTTERPGGFGYLGPSSMFFLY*
19 >lcl|XP_001090166.2|Plus17245620..7246369 NW_001122911 pleckstrin homology domain-containing family F member 2-like LOC701884 __SEG__ Chr8 {Macaca mulatta} MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFA
VYAATATEKSEWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGDMATCQ
PARSDSYSQSLKSPLNDMSDDDDDDDSSD*
20 >lcl|XP_001090199.1|Plus1complement(4964753..4966810) NW_001104434 kelch repeat and BTB domain-containing protein 7 isoform 4 KBTBD7 __SEG__ Chr17 {Macaca mulatta} MQSREDAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQA
SVTMHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFDHHKLRSQAQSYIAQNFKQLSRMGSIREETLADLTLA
QLLAVLRLDSLDIESERTVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSSSSNSLVS
AAENPPQRLGMCAKEMVIFFGHPRDPFLCYDPYSGDIYTMPSPLTSFAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYI
LGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISN
IPLDSETHNYQIVNHDRKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSS
SSFSDDEVWVQVAPQRNAQDQQGSL*
21 >lcl|XP_001090920.1|Plus11329517..1330206 NW_001118147 n-alpha-acetyltransferase 11, NatA catalytic subunit-like LOC696758 __SEG__ Chr5 {Macaca mulatta} MNIRNARPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLH
VRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLSQMADELRRQVDLKKGGYVVLGSRENQETQGSTLCGSEEACQQKNPDTEESGSDSKEPKESVESTNVQD
SSEGSDSTS*
22 >lcl|XP_001091185.1|Plus1complement(3426037..3426906) NW_001122886 claudin-23 isoform 2 CLDN23 __SEG__ Chr8 {Macaca mulatta} MRTPVVMTLGMVFAPCGLLFNLTSTLAPGWRLVKGFLDQPVDVELYQGLWDMCREQSSSERECGQQDEWGYFEAQPVLVARALMVTSLAVTVLGLLLASLGVRCWQDEPN
FVLAGLSGLVLFVAGLLSLIPVSWYSHFLRDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALSFAPWCKERRKAPSAGPRRSSVSTIQVEWPEPELTPAIKYY
SDGQHRPPPAQHRKPKPKVGFPMPRPPPKAYTNSVDVLAGEGWEAAQSQDSTSCSSHPCGSTLPCDSDL*
23 >lcl|XP_001091200.1|Plus1complement(1333452..1334057) NW_001218170 ras-related protein Rab-9B RAB9B __SEG__ ChrX {Macaca mulatta} MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYAD
VKDPEHFPFVVLGNKVDKEDRQVTTEEAQAWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC*
24 >lcl|XP_001091332.2|Plus14655845..4656705 NW_001112550 n-acetyltransferase 6-like isoform 1 LOC703022 __SEG__ Chr2 {Macaca mulatta} MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTVDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRASRLHSLGQSSDAFPLCLMLLSP
HPTSEAAPIVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRCLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGKPVQGLVFTSRRLPATLLNAFPTGPSPRP
PWKAPNLTAQAAPRGPKGLPLPPPPPLPECLTTSPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI*
25 >lcl|XP_001091479.1|Plus1complement(2242358..2243989) NW_001095158 zinc finger protein 280B isoform 1 ZNF280B __SEG__ Chr10 {Macaca mulatta} MEQSCEEDKEPEPQKNIKETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKPVVSNILNRVTPGSWSRRKKYGHLRKDTADKLQPTSHETLTSEAVTDLPASHLESR
STDSPIIIEPLSKPDYKNSSPQVVPNNSSELPSPLITFTGSLHQPVSAALSVGGINESPHISKRLSTFEVNSINAKRAKLRDGIMEGYSSASSPSDTFHTMNSQQSTPSN
NVHTSLSHVQNGAPFPAAFPKDNIHFKPINTNLDRENELTKTDILSLTSQNKTFDPKKENPIVLLSDFYYGQHKGDGQPEQKTHTTFKCLSCVKVLKNVKFMNHVKHHLE
FEKQKNDSWENHTTCQHCHRQFPTPFQLQCHIENVHTAQEPSAVCKICELSFETDQVLLQHMKDHHKPGEMPYVCQVCHYRSSVFADVETHFRTCHENTKNLLCPFCLKI
FKTATPYMCHYRGHWGKSTHQCSKCRLQFLTFKEKMEHKTQCHQMFKKPKQLEGLPPETKVTIQVSLEPLQPGSVEVASITVNTSDSEPSLPRSKSKISKKSH*
26 >lcl|XP_001091775.1|Plus13531524..3531952 NW_001122913 synaptojanin-2-binding protein SYNJ2BP __SEG__ Chr8 {Macaca mulatta} MNGRPVYLVAEEEISLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSHIKENGAAALDGRLQERDKILSINGQDLKNLLHQNAVDLFRNAGYAVSLRVQHRLQVQNGPIGEG
DPSGIPIFMVLVPVFALTMVAAWVFMRYRQQL*
27 >lcl|XP_001092268.2|Plus1complement(2548737..2549894) NW_001096638 mTERF domain-containing protein 3, mitochondrial-like LOC703925 __SEG__ Chr11 {Macaca mulatta} MLWKLLLRSQSCRLCSFKKMQSPPKYRPFLACFIYTTDRQSSKENTRTVEKLYKFSVDIRKIRRLKGWVLLEDKTYVEEIANILQELGADETAVASILERCPEAIVCSPT
AVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELELKNVVISRLLTTASNVFHNPVEKNKQMVRILQESYLDVGGSEANMKVWLLKLLSQNPFIL
LNSPAAIKETLEFLQEQGFTSFEILQLLSKLKGFLFQLCPRSIQNSISFSKNVFKCTDHDLKQLVLKCPALLYYSVPVLEERMQGLLREGISIAQIRETPMVLELTPQIV
QYRIRKLNSLGYRIKDGHLANLNGSKKEFEANFGKIQAKKVRPLFNPVAPLNVEE*
28 >lcl|XP_001092285.2|Plus1complement(2417564..2417947) NW_001118157 tryptophan-rich protein WRB __SEG__ Chr5 {Macaca mulatta} MGMAKANCWVWLLVLRFLFGCRVLQILLPSFSFMARVQRKDAKQESQMRAEIQDMKQELSAVNMMVKFARSARLERKINKMTNKLKTHVKA*TAQSGMIKWVLSVAFYKL
PATVIRLSDSLVGLSIT*
29 >lcl|XP_001092552.1|Plus1complement(1703745..1704623) NW_001102961 phosphoethanolamine/phosphocholine phosphatase isoform 2 PHOSPHO1 __SEG__ Chr16 {Macaca mulatta} MCQHLWPWPANQPLPGGLLPRPLSLAPSSSSSCCSPPCSQDGGMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGFYNEYMQRVFKYLGEQGVR
PRDLRAIYEAIPLSPGMGDLLQFVAKQGACFEVILISDANTFGVESALRAAGHHSLFRRILSNPSGPDARGLLALRPFHTHSCTRCPANMCKHKVLSDYLRERAHDGVHF
ERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKSC*
30 >lcl|XP_001093503.1|Plus14322125..4324005 NW_001218103 DDB1- and CUL4-associated factor 8-like protein 2-like LOC702202 __SEG__ ChrX {Macaca mulatta} MSHQEGSTDGLPDLGTESLFSSPEEQSGAVAATEDSSDIDIATSEQSVTMTGDDSDTRDGGFPNDVGTENRSSDRESASEDIELDSMEDFEHFLMSGESLFHYPLVGEEE
TEREEEEEEIQEEGREEAEGGEEAEEEEEEEEQPRAGPQCSGANHEQYLLEEDRALEEWVSSETSALPLPRWQVVTALHQRQLGSRPRFVYEACGARAFVQRFRLQYRLA
DHVGCVNTVHFNQRGTRLASSGDDLKVIVWDWVRQRPVLNFESGHTNNVFQAKFLPNCGDSTLAMCARDGQVRVAELINASYFENTKCVAQHRGPAHKLALVPDSPSKFL
TSGEDAVVFTIDLRQDRPASKVVVTREKDKKVGLYTITVNPANTYQFAVGGQDQFVRIYDQRRIDEKENNGVLKKFTPHHLVNCVFPTNITCVVYSYDGTELLASYNDED
IYLFDSSHSDGAQYTKRFKGHRNNTTVKGVNFYGPRSEFVVSGSDCGHIFFWEKSSCQIIQFLKGNREGTINCLEPHPYLPVLATSGLDHNVKIWTPTAKAATELTGLKK
VIKKNKWERDEDSLHHASLFDQYMLWFLMRHLTQRGHHRGWRSGEAEFPDEESDESSSTSETSEEEGQDRVQCMPS*
31 >lcl|XP_001093859.1|Plus1complement(4559304..4561139) NW_001218103 DDB1 and CUL4 associated factor 8-like 1 DCAF8L1 __SEG__ ChrX {Macaca mulatta} MSHQEGSTDGLPDLGTESLLSSPEEQSGAAVVTAASSDTEMAAAEPSTGDGGDTRDGGFPNDASTENQDTDPESSSEDVELESVEDFEHFLVSGEGLFYYPLVGEEETER
EEEEEEMEEEEGEEEEEQPRVCTRCGGANHEQCLLEEDRALEEWISSETSALPRPRWQVLTALRQRQLGSSARFVYEACGARAFVQRFCLQGLLGGHAGSVSTVHFNQRG
TRLASSGDDLRVIVWDWVRQKPVLNFESGHDINVIQAKFFPNCGDSIMAMCGHDGQVRVAELINASYCENTKRVAKHRGPAHELALEPDSPYKFLTSGEDAVVFTIDLRQ
DRPASKVVVTREKDKKVGLYTISMNPANIYQFAVGGHDQFVRIYDRRRIDEKENNGVLKKFTPHHLVNCDFPASITCIVYSHDGTELLASYNDEDIYLFNSSHSDGAQYV
KRYKGHRNNATIKCVNFYGPRSEFVVSGSDCGHVFFWEKSSCQIIQFMEGDRGGIVNCLEPHPYLPVLATSGLDQHVKIWTPTAQAATELTGLKDVIKKNKQERDEDNLH
HIDPFDNHMLRFFMRHLSQRAHHSGWRGHGAEFPNEELDESSSTSDTSEEEGQDRVQCLPS*
32 >lcl|XP_001094054.1|Plus17822927..7823502 NW_001118143 rho-related GTP-binding protein RhoH isoform 1 RHOH __SEG__ Chr5 {Macaca mulatta} MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTP
VLVVATQTDQREMGPHRASCINAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF*
33 >lcl|XP_001094754.1|Plus1complement(8868124..8868903) NW_001104434 BTB/POZ domain-containing protein KCTD4 isoform 1 KCTD4 __SEG__ Chr17 {Macaca mulatta} MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLL
AQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFIKSENGTRLVLKEDNTFVCTL
ETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK*
34 >lcl|XP_001095408.2|Plus11479282..1480550 NW_001121235 zinc finger and BTB domain-containing protein 42-like LOC706991 __SEG__ Chr7 {Macaca mulatta} MEFPEHGGRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNCDIVTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDI
VKVCKGRLQEKDRSLDPGNPAPGAEPGQPLCPWPVWTADLCPAARKAKLPPVGVKAALPPRASGPPPCQVPEESDQVLDLSLKPGPRQERVHPPCILQTPLCSQVQPGAQ
PLVKDERDSLSEQEESSSSRSTHSPPKPRPVPAAKGPVVGLQPLPVSGEGSRELELDVGRLASEDELGPRGPLCICPLCSKLFPSSHVLQLHLSAHFRERDSTRARLSPE
GAAPTCPLCGKTFSCTYTLKRHERTHSGEKPYTCVQCGKSFQYSHNLSRHTVVHTREKPHACQWCDRRFTQSGDLYRHVRKFHCGLVKSLLV*
35 >lcl|XP_001095631.1|Plus1complement(3871190..3871876) NW_001108704 GTP-binding protein Di-Ras3 DIRAS3 __SEG__ Chr1 {Macaca mulatta} MGNVSFRSKEQQLLQRLRLLPALLVLRAFKSHRRIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDSNRALQRHVIARGH
AFVLVYSVTKKETLEELKAFYELIRKIKGNNLHKFPIVLVGNKSDDIHREVTLHDGATCAMEWNCAFMEISAKTDMNVHELFHMLLNYKQQPTDLQEPEKESQMPNTTEK
LLDKCIIM*
36 >lcl|XP_001095683.1|Plus1complement(379370..380941) NW_001121008 germ cell-less protein-like 1-like GMCL1L __SEG__ Chr6 {Macaca mulatta} MGSSSSRVLRQPRRALAQQEQGARAGGLAGRPDPGDPAAGYGFCYCPGSHKSSGAFRYCRPDSERDEDEEERDEQQPLLHIPARKKLRSTSKYIYQTLFLNGEDSDIKIC
ALGEEWRLHKIYLCQSGYFSSMFSGSWKESSMNIIELEIPDQNIDVEALQVAFGSLYRDDVLIKPSRVVAILAAACMLQLDGLIQQCGETMKETITVKTVCGYYTSVGTY
GLDSVKKKCLEWLLNNLMTHQNVKLFKELSINVMKQLIGSSNLFVMQVEMDVYTALKKWMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEDMAFLETEQGKPFVSVFRH
LRLQYIISDLASARIIEQDAIVPAEWLSSVYKQQWFAMLRAEQDSEVGPQEIDKEELEGNSMRCGRKLAKDGEYCWCWTGFNFGFDLLVTYTNRCVIFKRNTLNQPCSGS
VSLQPQRSIAFRLRLASFDSSGKLICSRTTGYQILILKKDQEQVVMNLDSRFLTFPLYICCNFLYISPEKRIENNHHPENPEN*
37 >lcl|XP_001096089.1|Plus1complement(7610895..7611581) NW_001112548 BTB/POZ domain-containing protein KCTD6-like LOC701810 __SEG__ Chr2 {Macaca mulatta} MTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEE
VVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFC
RLARKTDD*
38 >lcl|XP_001096115.1|Plus14269552..4270709 NW_001121191 UPF0580 protein C15orf58 homolog isoform 1 C7H15orf58 __SEG__ Chr7 {Macaca mulatta} MALPHDSNETSYLLPPNNEDWDRQAIPDFVYGQKDLMAEGIQWPRNAPGVLEALPQSPFDAALCSAWKQRVELGLFRYRLRELQTQILPGVVGFVAQLNVERGVQRRRPQ
TIKSVRQAFDPEQFNFNKIQPGEVLFRLHREPDLPGTLLQEDILVVINVSPLEWGHVLLVPEPARGLPQRLLPGALRAGIEAVLLSLHPGFRVGFNSLGGLASVNHLHLH
GYYLAHRLPVEQAPSEPLDPGGHLHLLQGLPAPGFLFYTRGPGLDLESLICRVCRATDYLTDHEIAHNLFVTRGAPPGKTSPSSALTGVRVILWARKSCFGIKDGEAFNV
ALCELAGHLPVKTSQDFSSLTEAAAVALIQDCRLPPSQAEEVQAALVALMSQKEQ*
39 >lcl|XP_001096238.1|Plus11465521..1467917 NW_001218125 zinc finger X-linked protein ZXDB ZXDB __SEG__ ChrX {Macaca mulatta} MEIPKLLPARGTLQGGHGGIPAGGGRVHRGPDPPAGQVPTRRLLLLRGPQDGGPGRRCEEAGTASRGPGPSLLAPRPDQPSGGGGDDFFLVLLDPVGGDVETVGSGQATG
PVLREEAEEGPGFQGGESGANSAGRTALGPRCLSAVPTQAPISAPGPAAAFTGTVTIHNQDLLLRFENGVLTLATPPSHSWEQGAAPAQQPGCLIAPQAGFPHAAQPGDC
PELPPDLLLAEQAEPAPAPAPEEEAEGPAAALGPRGPLGSGPGMVLYLCPEAQCGQSFAKKHQLKVHLLTHSSSQGQRPFKCPLGGCGWTFTTSYKLKRHLQSHDKLRPF
GCPAEGCGKSFTTVYNLKAHMKGHEQENSFKCEVCEESFPTQAKLSAHQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLKIH
LRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKHDDDRRFMCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVEGCCARFSARSSLYIHSKKHLQDVDTWKSRCPISTC
NKLFTSKHSMKTHMTKRHKVGQDLLAQLEAANSLTPSSELTSQRQNDLSDAEIVSLFSDIPDSTSAAVLDTALVNSGILTIDVASVSSTLAGHLPANSNSVGQAVDPPAL
MATSDPPQSLDTSLFFGMAATGFQQSPLDMDEVSSVSVGPLGSLGSLAMKNSSPEPQALTPSSKLTVDTDALTPSSTLCENSVSELLTPTKAEWNVHPDSDFFGQEGETQ
FGFPNVAGNHGSQKETDLITVTGSSFLV*
40 >lcl|XP_001096286.1|Plus1complement(578868..579986) NW_001109115 UPF0558 protein C1orf156 isoform 1 C1H1orf156 __SEG__ Chr1 {Macaca mulatta} MTFQFNFTIEDHLENELTPTGDGALTLDSSKELSVSESQKGEDRDRKCSAEQFDLPQGHLWEHKSMENAAPSQDTDSPLSAANNSSNLEPYGKQPSLRAAKEHAMPKDLK
MLENKVIETLPGFQHVNFSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGAKEIHFQDYNSM
VIDEVTLANVVANSTLEDEENDVNKPDLKRCKKPKVTQELYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLASKAHYFGV
GGGVHLFQKFIEERDVFKTRILKIIDEGLKRFIIEITFKSPG*
41 >lcl|XP_001096298.1|Plus1682267..682857 NW_001098991 rho-related GTP-binding protein RhoB-like isoform 1 LOC702141 __SEG__ Chr13 {Macaca mulatta} MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNV
PIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL*
42 >lcl|XP_001096996.1|Plus1complement(3581735..3584407) NW_001112550 putative RNA-binding protein 15B RBM15B __SEG__ Chr2 {Macaca mulatta} MKRQSERDSSPSGRGSSSSAKRPREREREAEAGGRRAAHKASGGAKHPVPARARDKPRGSGSGGGGHRDGRGTGDANHRASSGRSSGSGAGGGGRGGKASGDPGASGLSP
RASPLPPPPPPPGAEPAGPGSSAAAPEYKTLLISSLSPALPAEHLEDRLFHQFKRFGEISLRLSHTPELGRVAYVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLR
GGGGSSRRSSSSSAAASTPPPGPPAPTDPLGYLPLHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYPTVCEEDLMPE
DDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAREFDR
FGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDTDLVRDRTPPHLLYSDRDRTFLEGDW
TSPSKSSDRRNSLEGYSRSVRSRSGERWGGDGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGA
EERGHHHHHHEAADSSHGKKTRDSERNHRPTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRLR
LDQPKLDEVTRRIKQGSPNGYAVLLATQATPSGLGTEGMPTVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDGTGMLYAFPPCDFSQQYLQSALRTLGKLEEEH
MVIVIVRDTA*
43 >lcl|XP_001097093.1|Plus1complement(1277663..1279177) NW_001101674 zinc finger and BTB domain-containing protein 34 ZBTB34 __SEG__ Chr15 {Macaca mulatta} MSVEMDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLSISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAA
SFLQMQCVIDKCTQILESIHSKISVGDVDSVTVGAEENPESRNGVKDSSFFANPVEISPPYCSQGRQPTASSDLRMETTPSKALRSRLQEEGHSDRGSSGSVSEYEIQIE
GDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAASQPTNVSEAFGSLSNSSPSRSMLSCFRGGRARQKRAL
SVHLHSDLQGLVQGSDSEAMMNNPGYESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIRGHTDDKPFRCEICGKC
FPFQGTLNQHLRKNHPGVAEVRSRIESPERTDVYVEQKLENDASASEMGLDSRMEIHTVSDAPD*
44 >lcl|XP_001097208.1|Plus1complement(1326565..1327968) NW_001101674 zinc finger and BTB domain-containing protein 43 isoform 1 ZBTB43 __SEG__ Chr15 {Macaca mulatta} MEPGANSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFL
QMWHVVDKCTEVLEGNPTVLCQKLNHGSDHQSPSSSSYNGLVESFELGSGDHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGAS
DSAEFHYTRPMYSKPSIMAHKRWIHVKPERLEQACEGMDVHAAYDEHQVTESINTVQTEHTVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERS
DGNLIGHRQEAALAAGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWR
DSFHRHVTSCTKSYEAAKAEQNTTEAN*
45 >lcl|XP_001098027.1|Plus1complement(2072688..2075906) NW_001118139 zinc finger protein 518B-like LOC713122 __SEG__ Chr5 {Macaca mulatta} MKDIGQQLYTTHLKGGHNSLTMSPKQPDANGTPRPDRQEAQTLLYQGSEAEAAMMTIATCAKCKSVHKISLQDLQKGTGKDGIYVCFQCSLGAAPPNFHFVSNNPSATHV
GNKTENFSSPVSNKFKVRNFKPGKYYCDKCRFSTKDPLQYKKHTLQHEEIKFICSHCSYISYTKGEFQRHLVKHTGIFPYQCEYCDYGAIRNDYIVKHTKRVHERAGAKR
PVKAVAKLEPKRTGTSKQNPELLKASSPRTAFQNKWSDQLSGFSLHANKDKMHNIMLLPEPKEYQKDVVCIPNKMTLSEPNEVNLFENKNVEVEVLSPAKEPVQPGMPLT
VVAPAELVVPANCLAQLIDVKVVNGTQQLVLKLFPLEENNCLEAGRGNGGDSERMVNEKSSNEQEKILSAEKTKSLTVDRNVGKLVGIDSFQPSVQKQLKNVKWVRSYDF
IMPSSSVHNNGKSFINSETIEDFQKKNNLYPHRTAFPSVALKGHSLASVFKNSVLRSLGAASNPFPYKAAVCFAENGRNLHSNSQQLLPFAASPATFSFSGQKGLLPISE
NDLESTSKISIPVKMVSSNRKQEDNQTEEHKAVSTVGQISSQRKSEYLHINITGEDRSQQPGDKPLELKNSERTNNTNDGPVISSVFSLSSGSENVPEGIKWNSSTSKIK
SIELLRRKIAQLIESCGKPSSLASNSAHRRSVGQASKGTSKATSEGIQEINVSVTGPGHPTGTPQKPPDDGGVTGNGQLTHQQIYPHFADGSNRKTKSRVARKAHVATPV
LIPKGAVLRVLNSSEDAHIIEATCEAPVSIPCSETQLIKPVPFCPVKQADSEPLRSESGPIDMSQNIETPLRPKLRKESAVCSTIHKKTGLLHGQQGSSELSKQGRLLSR
SLSISRNKTKQVHLSKKKNKIQAEPSHCLKDPSIFQVARQLRLIAAKPDQLIKCPRRNQPVIVLNHPDVDSPEVTNVMKVINKYKGNVLKVVLSERTRCQLGIRRHHVRL
TYQNAEEASQIKRQMMLKMKLKKVHKNNYQVVDSLPDDSAQCVFKCWFCGRLYEDQEEWMSHGQRHLIEATRDWDVLSSKGK*
46 >lcl|XP_001099006.1|Plus1complement(363241..363837) NW_001106349 GTP-binding protein Di-Ras1-like isoform 1 LOC711495 __SEG__ Chr19 {Macaca mulatta} MPEQSNDYRVVVFGAGGGGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGS
VEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM*
47 >lcl|XP_001099525.1|Plus1complement(44113..44712) NW_001101686 GTP-binding protein Di-Ras2-like isoform 1 LOC703987 __SEG__ Chr15 {Macaca mulatta} MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGD
VESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM*
48 >lcl|XP_001099626.2|Plus1complement(811113..812027) NW_001105671 mitochondrial carrier triple repeat protein 1-like isoform 2 MCART6 __SEG__ Chr18 {Macaca mulatta} MKKILSNVMDSEAHEKRPPVLTSSKQDISPHITNDGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQLYGIQTRDAILQLRRDGFRNLYRGILPPLMQKTTTLSLMFGLYE
DLSCLLHKHVSAPEFATRSVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQVFKALKCYGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTPSAHFVS
DFISGGLLGAMLGFLIFPINVVKTRIQSQIGGEFQSFRKVFQKIWLERDRKLINLFRGAHLNYHRSIISWGIINATYEFLLKVI*
49 >lcl|XP_001100517.1|Plus12479186..2483631 NW_001124218 zinc finger protein 518A isoform 3 ZNF518A __SEG__ Chr9 {Macaca mulatta} MPSEQKELFCDEKQTTLKKDYDVKNEIVDRSVLKPKISESIHYELKNVKIHLPKINIPNEVLLKHEVDKYRKLFQSKQQTARKSISIKTVSCVEECTLLHKSERAEEEGI
KMSAKILNFSCLKCRDNTRYSPNDLQKHFQMWHHGELPSYPCEMCSFSANDFQVFKQHRRTHRSTLVKCDICNNESVYTLLNLTKHFTSTHCVNGNFQCEKCKFSTQDVG
TFVQHIHRHNEIHYKCGKCHHVCFTKGELQKHLHIHSGTFPFTCQYCSYGATKREHLVRHVITLHKEHLYAKEKLEKDKYEKRMAKTSAGLKLILKRYKIGASRKTFWKR
KKINSGSDRIIEKNTQVLQKMNKTQTKSEDQSHVVQEHLSEEKDEGLHCENNDKAPESESEPTPVSTGQGNKAEEGPNASSGFMKTAVLGPTLLMLKNNKITVPPNYSAK
FMGFKMMDGKQHIVLKLVPIKQNICSPDSHSGAAKDSTANLQPQTLDTNGFLTGVTTELNDTVYMKAATPFSCSSSILSGKASSEKEMTLISQRNNKLQTVDNEKSVSSL
STTSELVTSSVNLTTKFETRDNVDFWGNNLTQSHPEVLGTTIKSPDKVNCVAKPNAYSSGDMHNYCINYVNSELPVESSNQGSLPFHNYSKVNNSNKRRRFSGTAVYENP
QRECSSSKTVVQQPISESFLSLVRQETSKPDSLLASISLLNDKDGTLKAKSEIEEQYVLEKGQNIDGQNLYSNENQNLECATEKSKWDDFSNVDSPMMPRITSVFSLQSQ
QASEFLPPEVNQLLQDVLKIKPDVKQDSSNTPNKGLPLHCDQSFQKHEGESKIVESSKDFKVQGIFPVPPGSVGINVPTNDLNLKFGKEKQVPSMPQDVRDSEKMPRISG
FGTLLKTQSDAIITQQLVKDKLRATTQNLGSFYMQSPLLNSEQKKTIIVQTSKGFLIPLNITNKPGLPVIPGNALPLVNSQGIPASLVVNKKPGMILTLNNGKLEGVSAV
KTEGAQAHGTMTKEPCKTPILKVEPNSNCLTPGLCSSIGSCLSMKSSSENTLPLKGPYVLKPTSSVKAVLIPNMLSEQQSTKLNISDSVKQQNEIFPKPPLCTFLPDGKQ
AVFLKCVMPNKTELLKPKLVQNSTYQNIQPKKPEGTPQRILLKIFNPVLNVTAANNLSVSNSASSLQKDNVPSNQIIGGEQKEPESSRDALPFLLDDLMPANEIVITSTA
TCPESSEEPICVSDCSESRVLRCKTNCTVERNFNRKKTSKKIFSKTKTHGSQDSETAVVSRNRNCKRKCRDSYQEPPRRKATLHRKCKEKAKPEDVRETFGFSRPRLSKD
SVRTLRLFPFSSKQLVKCPRRNQPVVVLNHPDADAPEVVSVMKTIAKFNGRVLKVSLSKRTINALLKPVCYNPPKTTYDDFSKRHKTFKPVSSVKERFVLKLTLKKTSKN
NYQIVKTTSENILKAKFNCWFCGRVFDNQDTWAGHGQRHLMEATRDWNMLE*
50 >lcl|XP_001100607.1|Plus1complement(10914804..10915967) NW_001121210 WD repeat-containing protein 89 isoform 1 WDR89 __SEG__ Chr7 {Macaca mulatta} MEKIEEQFANLHIVKSSSGTKEPTYLLGIDTSKTVQAGTETVAAVLCSNGSIRIYDKERLNVLREFSGYPGLLNGVRFANSCDSVYSACTDGTVKCWDARVAREKPVQLF
KGYPSNIFISFDINCNDHIICAGTEKVDDDALLVFWDARMNSQDLSTTKDPLGAYSETHSDDVTQVRFHPSDPNMVVSGSSDGLVNVFDINVDNEEDALVTTCNSISSVS
CIGWSGKGYKQIYCMTHDEGFYWWDLNHLDTDEPVTRLNIQDVREAVNMKEDSLDYLIGGLYHEKTDTLHVIGGTNTGRIHLMNCSMSGLTHVTSLQGGHAATVRSFCWN
VQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQRVRVHSNDSYKRRKKQ*
51 >lcl|XP_001101713.2|Plus118729571..18731085 NW_001122913 tRNA wybutosine-synthesizing protein 2 homolog TRMT12 __SEG__ Chr8 {Macaca mulatta} MGENVVVSNMERETGKPVAVVAVVTEPRFTQRYREYLERQKLFDTQHRVEKMPDGWVALPVLGETLPEQHLQELRNRVAPGSACMLTRLPDPVPSKRAQGCSPAQKLCLE
VSRWVEGRGVKWSAELEADLPRSWQRHGNLLLLSEDCFQANQWKNLGPELWETVASALGVQRLAKRGRVSPDGTRTPAVTLLLGDHGWVEHVDNGILYKFDVTQCMFSFG
NITEKLRVASLSCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEINGVADRCQIHFGDNRKLKLSNIADRVILGLIPSSEEGWPIACQVLRQDAG
GILHIHQNVESFPGKNLQPLEVSKTEKEHWLYPQQITTNQWKNGATRDTRGKMLSPATKPEWQRWAESAETRIATLLQQVHGKPWKTQILHIQPVKSYAPHVDHIVLDLE
CCPCP*VG*RRWTLGHMGSMYEWSLLYLFSRGCHPFCPLVISVFHIL*P*KQALDQFKLFHLSSI
52 >lcl|XP_001101765.1|Plus1892407..893162 NW_001101661 haloacid dehalogenase-like hydrolase domain-containing protein 3-like isoform 1 LOC705447 __SEG__ Chr15 {Macaca mulatta} MAHRLQIRLLTWDVKDTLLKLRHPLGEEYATKARAHGLEVEPSALEQGFRQAYRVQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYEDFSRPCT
WQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGALGLREHFEFVLTSEAAGWPKPDPRIFQEALRLAHTEPVVTAHVGDNYLCDYQGPRAVGMHSFLVVDPQALDPV
VRDSVPKEHILPSLAHLLPALDCLEGSTPGL*
53 >lcl|XP_001101805.1|Plus11987950..1988651 NW_001218118 GTPase ERas-like LOC711442 __SEG__ ChrX {Macaca mulatta} MELPTKPGTFDLGLATWSPSFQGETHRAQARCRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCL
AVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKAR
HQKATCHCGCSVA*
54 >lcl|XP_001102554.1|Plus11715596..1716243 NW_001096636 high mobility group protein B1-like LOC713250 __SEG__ Chr11 {Macaca mulatta} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMSKADKARYEREMKTYISPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE*
55 >lcl|XP_001103216.1|Plus1complement(3644829..3646598) NW_001120973 ectoderm-neural cortex protein 1 ENC1 __SEG__ Chr6 {Macaca mulatta} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
56 >lcl|XP_001104336.1|Plus1complement(4807574..4808581) NW_001095180 protein Tob2 isoform 2 TOB2 __SEG__ Chr10 {Macaca mulatta} MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKNKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVK
VLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPPQQPRMA
RSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQPFQP
VVLAN*
57 >lcl|XP_001104907.2|Plus15309815..5311461 NW_001120983 ankyrin repeat domain-containing protein 43-like LOC708755 __SEG__ Chr6 {Macaca mulatta} MALAAAAAAAAAGVSQAAVLGFLQEHGGKVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKELDGVKFVVLRKKPRPPEPEPAPFGPQGAAAQPSKPTVVLP
GDASAPGAPPLVPVPRQVEPPGDLGPLTETQDTPRGPASEPAQPAGERSADPPLPALELAQAPEGPSADAAPPPRASSEAASPCSDPPDPEPGPGAAKGPSQQKPCMLPV
RCVPAAATLRIRAEEQGLRRQLSEEPSPRSSPLLLRRLSVEESGLGLGLGPGRSPHLRRLSRAGPRLLSPDAEEVPAAPPPSAVPLEPSEHEWLVRTAGGRWTHQLHGLL
LRDRGLAAKRDFMSGFTALHWAAKSGDGEMALQLVEVARRSGAPVDVNARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVNVRDHSGRRAYHYLRPGSSYALRRLLGDP
GLRSTTEPDATGGGSGSLAARRPVQVAATILSSTTSAFLGVLADDLMLQDLARGLKKSSSFSKFLSASPMAPRKKTKIRGGLPAFSEISRRPTPGPLAGLVPSLPPTT*
58 >lcl|XP_001105263.1|Plus1complement(1149585..1150268) NW_001099002 probable N-acetyltransferase 8-like NAT8 __SEG__ Chr13 {Macaca mulatta} MAPYHIRKYQESDRKWVVRLLSQGMAEHIPATFWQLLKLPRTLILLLGGPLALLLVSGSWLLALMFSLSLLPALWFLAKKPWMDYVDTVLRTDMSDITKSYLSEPDSCFW
VAESEEKVVGMVGALPVDDPTLKEKRLQLFHLSVDSEHRCQGIAKALIRTVLQFARDQDCSAVVLDTSNIQLTALSLYQSMGFQKTGQSFSCMWARLVAHITIHFIYRLP
SSQAGGL*
59 >lcl|XP_001106513.1|Plus1190110..193310 NW_001114156 zinc finger protein 295-like isoform 3 ZNF295 __SEG__ Chr3 {Macaca mulatta} MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQAVFQLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLG
ISFLTNIVSKTPQAPFPACPNRKKVFVEDDENSSQKRSVIVCQSRNEAQGKTVSQNQPDVSHTSRPSPSIAVKANTNKPHVPKPIEPLHSLSLTEKSWPKDSSVGYAKSL
EHSGSLDDPNRISLVKRNAVLPSKPLQDREAMDDKPGVSGQLPKGKALELALKRPRPPVLSLCSSSETPYVLKETNKGNGQGEDRNLLYYSKLGLVIPSSGSGSGNQSID
RSGPLVKSLLRRSLSMDSQVPVYSPSIDLKSSQGSSSVSSDAPGNVLCALSQKSSLKDCSEKTALDDRPQVLQPHRLRSFSASQSTDREGASPVTEVRIKTEPSSPLSDP
SDIIRVTVGDAAATAAASSSSVTRDLSLKTEDDQKDMSRLPAKRRFQADRRLPFKKLKVNEHGSPVSEDNFEEGSSPTILDADFPDSDLNKDEFGELEGTRPNKKFKCKH
CLKIFRSTAGLHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGIVKNPSPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRGKPGFQGQSSSQAQQVIKR
NLRSRAKGAYICTYCGKAYRFLSQFKQHIKMHPGEKPLGVNKVAKPKEHAPLASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKC
EYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMAPTENFSLPVLDHNGDVTGSSRPQSHPEPNKVNHIVTTKDDNVFSDSSEQVNFDSEDSSCLPEDLSLSKQLKIQVKE
EPVEEAEEEAPEASTAPKEAGPSKEASLWPCEKCGKMFTVHKQLERHQELLCSVKPFICHVCNKAFRTNFRLWSHFQSHMSQASEESAHKESEVCPVPTNSPSPPPLPPP
PPLPKIQPLEPDSPTGLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN*
60 >lcl|XP_001107033.1|Plus18518402..8519466 NW_001116511 membrane progestin receptor beta-like isoform 1 PAQR7 __SEG__ Chr4 {Macaca mulatta} MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSL
PLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYERFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLA
FILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFL
AACSAATAALLRHKVKARLTKKDS*
61 >lcl|XP_001107578.1|Plus153085..53783 NW_001102932 BTB/POZ domain-containing protein KCTD11-like LOC715066 __SEG__ Chr16 {Macaca mulatta} MLGAMFRAGTPMPPNLNPQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASRGTPAPTAALLHADVDASPRLVHFSARRGPH
HYELSSAQVDTFRANLFCTDPECLGALRARFGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGARREVVGTPSFLEEVLRVALEHGFRLDSVFPDPED
LLNSRSLRFVRH*
62 >lcl|XP_001107865.1|Plus1complement(332771..333811) NW_001111047 membrane progestin receptor alpha-like isoform 1 LOC713411 __SEG__ Chr1 {Macaca mulatta} MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFII
VLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPSWHARVQAVFLPMAAFLAWLSCTGSCYNKYIQKPGLLGRTCQEVPSALAYALDISP
VVHRIFVSSDPAIDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSVLTA
FLLSQLVQRRLDQKTK*
63 >lcl|XP_001107891.2|Plus110111717..10112931 NW_001112571 WD repeat and SOCS box-containing protein 2 WSB2 __SEG__ Chr2 {Macaca mulatta} MEAGEELLLLAELKPGRPHQFDWKSSCETWSIAFSPDGSWFAWSQGHCIMKLIPWPLEEQFIPKGFEAKNRSSKNETKGQGSPKEKMLDCGQIVWGVAFSPWPSPPSKRL
WAHHHPQVPDISCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHSKQIQVLLGHLQWVYCCSISPDCSMLCSAAEEKS
VFLWSMRSYTLIRKLEGHQSSVVSCDFSPNSALLVTASYDTNVIMWDPYTRERLRSLHHTQVDPAMDDSDVHVSSLRSVCFSPEGLYLATVADDRLLRIWALELKTPIAF
APVTNGLCCCTFFPHGGVIATEIRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPRK*KRPHIQDFL
64 >lcl|XP_001107984.1|Plus11341626..1342201 NW_001111147 high mobility group protein B4-like LOC710554 __SEG__ Chr1 {Macaca mulatta} MNMGKEIQLKPKANVSSYIHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQAPRRPPSSFLLFCQDHY
AQLKRENPSWSVVQVAKATGKMWSATTDLEKHPYEQRAALLRAKYFEELELYRKQRKQCNARKKYRMSARKRCRGKRVRQS*
65 >lcl|XP_001108564.2|Plus11268617..1269993 NW_001121157 kelch-like protein 9-like LOC708647 __SEG__ Chr7 {Macaca mulatta} MPRGPETPVQVWVGGQLFQAERALLVEHCGFFRGLFRSGMREARAAEVRLGVLSAGGFRVTLQVLRGERPALAAEDELLQAVECAAFLQAPALARFLEHNLTSDNCALLC
DAAAAFGLRDVFHSAALFIRDGECELAAELALPEARSYVAALRPSSYVAVSTHTPAPGFLEDASRTLCYLDEEEDAWRTLAALPLEASTLLAGVATLDNKLYIVGGVRGA
SKEVVELGFCYDPDGGTWREFPSPHQPRYDTALAGFDGRLYAIGGELQRTPVSSVERYDPAAGCWSFVADLPQPAAGVPCAQACGRLFVCLWRPADTTAVVEYAARTDAW
LPVADLRRPQSYGHCMVAHRDSLYVVRNGPSDDFLHCAIDCLNLATGQWTALPGQFVNSKGALFTAVVRGDTVYTVNRMFTLLYAIEGGTWRLLREKAGFPRPGSLQTFL
LRLPAGAPGPVASTTPEL*
66 >lcl|XP_001108950.1|Plus1263004..264611 NW_001121186 ankyrin repeat domain-containing protein 34C-like ANKRD34C __SEG__ Chr7 {Macaca mulatta} MMDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGETALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTALIHACIRRAGGEVVSLLLENGA
DPSLEDRTGASALVYAINADDKDALKHLLDACKAKGKEVIIITTDKSSSGTKTTKQYLNVPPSPKVEDRHSPPLYASPSDIELKSPGLDSPLTEKEDDFFSLQVGHPSSC
NTSKAVNEPGSPTRKVSNLKRARLPQLKRLQSEPWGLIAPSVLAASTRQDETRGASTENEVIKSISDVSFPKRGPLSRTNSIDSKDPTLFHTVTEQVLKIPVSSAPASWK
AAYEKGQTPHPRLARRGTLPVDQEKCGIVPSGPSALKEPASLKWLENDLYDLDLQPGPDPPNSISLESGKGPLDRKKLNSSHLSLFHGSRESLDTVPSTSPSSGRRRPPH
LLERRGSGTLLLDRISHTRPGFLPPLNVNLNPPIPDIRSSSKPSSPLTSGLKSMVPVAPSSPKRVDLRSKKKLLRRHSMQIEQMKQLSDFEEIMT*
67 >lcl|XP_001110036.1|Plus1complement(3163835..3164803) NW_001120974 RNA-binding motif protein, X-linked 2 RBMX2 __SEG__ Chr6 {Macaca mulatta} MNALTKVKLINELNEEEVKLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKVKGRTIRVD
HVSNYRAPKSSEEMDDVTKELHKGSRGAHTYSSSLSESSEDEKPTKKHKKEKKEKKKRKKEKEKTDRLVQGEQPSSSSPRSKTVKEKDDPGPKKHSSKNSGRAQKSQPRE
RRKLPEARTAYYGGVEDIEREQKKEKPKHEHKSSSGREAREETTRDRDRGRSSDTLSSPYNAHSERRSHRTRSRSRDKSHRHKKTRRSWKCESWNPSDRRRH*
68 >lcl|XP_001110392.1|Plus1complement(3369945..3371489) NW_001120974 ankyrin repeat domain-containing protein 34B-like ANKRD34B __SEG__ Chr6 {Macaca mulatta} MDEGMEISSEGNSLIKAVHQSRLRLTRLLLEGGAYINESNDRGETPLMIACKTKHVDHQSVSKAKMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGAD
LSLQDHSSYSALVYAINSEDTETLKVLLSACKAKGKEVIIITTAKSPCGKHTTKQYLNMPPVDIDGCHSPATCTTPSEIDIKTASSPLSHSSETELTLFGFKDLELTGSN
DDTWDPGSPVRKPALAPKGPKLPQAPPWIKSPPSLMHQNRVASLQEELQDITPEEELSYKTNGLALSKRFITRHQSIDVKDTAHLLRAFDQASSRKMSYDEINYQSCLSE
GNQQCIEVPADQDPDSNQTIFTSTLRSIVQKRNLGANHYSSDSQLSAGLTPPNLEDGKALVGKKKILSPSPSQLSESKELLENMPPGPLSRRNHAILERRGSGAFPLDHS
VTQTRQGFLPPLNVNSHPPISDINVNNKICSLLSCGQKVLMPTVPIFPKEFKSKKMLLRRQSLQTEQIKQLVNF*
69 >lcl|XP_001110707.1|Plus1complement(3715937..3716200) NW_001100386 coiled-coil-helix-coiled-coil-helix domain-containing protein 8-like LOC718275 __SEG__ Chr14 {Macaca mulatta} MSTSAPQGHTWTQRVKKEDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQSRRREELQRRKEQASAHH*
70 >lcl|XP_001111211.1|Plus1848823..850790 NW_001100384 ubiquilin-3 isoform 1 UBQLN3 __SEG__ Chr14 {Macaca mulatta} MAKGGEALPQGSPAPVQDPHLIKVTVKTPKDKEDFSVTDSCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRAMGSECPAASVPTQ
GPSPGSLPQPSSIYPADGPPAFSLGLLTGLNGLGLTYRGFPDQPSSLMRQHVSVPEFVAQLIDDPFIQGLLSNTGLVRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQT
LEFLRNPAMMQEMIRSQDRVLSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFATATTDNATTTTSQPSRMENCDPLPNPWTSTHGGSGSRQQRQDGDQDAADIR
NRFPNFLGIIGLYDYLQQLHENPQSLGTYLQGTASALSQSQERPPPVNRVPPLSPSSQEPRSGQPLPKESVAIKGRSSCPAFLRYPTENGTGKGGDQDGAGKSPTGHSTN
LPDLVSGLGDSANRVPFVPLTSSPTAAIPGIPEPPWLPSPPYPRSLRPDGMNPAPQLQDEIQPQLPLLMHLQAAMANPRAMQALRQIEQGLQVLATEAPRLLLWFMPCLA
GMGSVAGGIQSREDPLMSEDPLPNPPPEVFPALDSAELGFHSPPFLHMLQDLVSTNPQQLQPEAHFQVQLEQLRSMGFLNREANLQALIATGGDVDAAAEKLRQS*
71 >lcl|XP_001111310.1|Plus1complement(3717335..3718399) NW_001108671 protein KTI12 homolog LOC712824 __SEG__ Chr1 {Macaca mulatta} MPLVVFCGLPYSGKSRRAEELRMALAAEGRAVYVVDDAAVLGAEDPTVYGDSAREKALRGALRASVERRLSRHDVVILDSLNYIKGFRYELYCLARAARTPLCLVYCVRP
GGPSAGPQVAGAKENPGRNVSVSWRPHAEEDGRPQAAGSRVLKELHTAGSVVNGSVQADVPKELEREESGTAESPALVTPESEKSAKHVSGSFYSPELLEALTLRFEAPD
SRNRWDRPLFTLVGLEEPLPVAGIRSALFENRAPPPHQSTQSQPLASGSFLHQLDQVTSQVLAGLMEAQKSAVPGDLLTLPGTTEHLRFTRPLTMAELSRLRRQFISYTK
MHRNNENLPQLANMFLQYLSQSLH*
72 >lcl|XP_001111556.1|Plus1complement(445491..445907) NW_001106519 nanos homolog 2 NANOS2 __SEG__ Chr19 {Macaca mulatta} MQLPPFDMWKDYFNLSQVVWALIANRGQRLETQETEEPSPGPPLGQDQGLGGSGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHT
LKYCPLNGGQQSLYRRSGRNSAGRRVKR*
73 >lcl|XP_001111860.1|Plus117950526..17951659 NW_001112571 progestin and adipoQ receptor family member 9-like LOC714170 __SEG__ Chr2 {Macaca mulatta} MPRRLQPRGAGTKGPPAPAPAASGTARNAHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGG
DVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYVQQRLGWHVDCTRLIAAYRALVLPVAFVL
AVACTVACCKSRTDWCTYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVE
EGLRQFLQAPPAAPTFSGTVGYMLLLVVCLGLVIRKFLNNSEFCSKK*
74 >lcl|XP_001112263.1|Plus1complement(25682272..25683264) NW_001112540 WD repeat-containing protein 5B-like LOC714703 __SEG__ Chr2 {Macaca mulatta} MATKESGDARAQLALSSSASQSKEVPKNPNYALRCTLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLW
DVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPISFVRFSP
NGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLWISNH
*
75 >lcl|XP_001112739.2|Plus1complement(15148541..15149278) NW_001101663 tumor protein D55-like isoform 2 LOC715657 __SEG__ Chr15 {Macaca mulatta} MDLSRLKSDSTHQKSEPAGLDFDSAGQDYFSAAQEFDSFYQELNLDSLNEDLLSQFMPHARTETSVGTYESHSTSELEDLTEPEQRELKAKLTKLEAEIVTLRQVLAAKD
RRCGKLKRKLGFTALVGLRQNLSKSWLDVQVSNTYVEQKVSAALSTMGTALCRKLGGIKKSATFRSFEGLMGTIKSKVAGGKELGPDCLSSAEGGDDPLSVLGSGEDPLQ
ILGSGNDPLPVLENEDDQLCFLEPE*
76 >lcl|XP_001113290.1|Plus1complement(1504750..1506510) NW_001102932 major facilitator superfamily domain-containing protein 6-like LOC717575 __SEG__ Chr16 {Macaca mulatta} MNANPRWDISRALGVAKLFHLVCGVREACVTPFLTLYLRQLGLAAPWVGILMGTKHLIAAFWAPVCAFLAKSYRKRRVLLIGSLLSSVGASLLMVLIPAADKNRMHLPCN
GSSGVTSTDALPGVTLRVNITSAQGPASRHPANRTAEVEMPGFRNPPGESDRETFRDPHGYVAPSVEGARTTSQVLLHPVTSGLKDHPWEVTFEMVKTALPLLPAGKGPG
NPANLSGTKGKAWAFDLSLGGLRWTFILSLGSMAFWELLAAPLEQVADDSLYEYLDFVDATDRYRSLWVWRLLGMLAGVCGIAALVGQLDCFLMNSGPLGVVHFYGYSVV
STLALLVSIFFPIPICQRWEPSYKSVKALSIVGSDPRLILLAFTVVLTGAIVSTVQNFLFWHMKDHGSGELVMGFSVALSLLGEILLHPFKTALLRKLPRVGLVGLGLSC
LAGQLLYYSFLWSWWSVLPVQILSAISNGALWWAVGASVEDLATPRMERALSALFRGHFYGSGCSLGSFVGGFVVMRFSLAVLYQACCVALLLWLALLLSIQQRLPQERK
IKYSKLLSMEVSDTSDSEQGTERDWLVKAMREEHSD*
77 >lcl|XP_001113546.1|Plus11392492..1393067 NW_001100386 rho-related GTP-binding protein RhoG-like isoform 1 LOC718113 __SEG__ Chr14 {Macaca mulatta} MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPI
LLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCVLL*
78 >lcl|XP_001113734.1|Plus1complement(486673..488052) NW_001116486 zinc finger and BTB domain-containing protein 12-like ZBTB12 __SEG__ Chr4 {Macaca mulatta} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGVSEASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVA
HRLKPPGGLGGGLGIGGSVGGHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSGGNPL
KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGK
TTAENVLEASVAEINVLIR*
79 >lcl|XP_001114058.1|Plus13395..4180 NW_001100002 major facilitator superfamily domain-containing protein 9-like LOC719594 __SEG__ Chr13 {Macaca mulatta} LVWFFPWREAKPGSTDKGLPLRKTHVLLGRSHDAVQEAATNRGARASKKAARPWVEVGLALRNMKNLLFSEMWDIFLVRLLMAVAVMLYYSNFVLALEERFGVRPKVTGY
LISYSSMLGAVAGLALGPILRLYKHNSQVLLLHSSMLTCALLLLYSLAPTMGAVVLSSTLLSFSTAIGRTCITDLQLTVGGAQASGTLIGVGQSVTAVGRIIAPLLSGVA
QEVSPCGPPSLGTALALVAIFIMSLNRPHSSGDRNGKLKSE*
80 >lcl|XP_001114193.1|Plus128934506..28935159 NW_001112540 ubiquinone biosynthesis protein COQ7 homolog LOC716130 __SEG__ Chr2 {Macaca mulatta} MSCARAAAAPCLWRLRTGARRSLSAYGRRIIVRFRSSGMTLDNINWAVVDRIIWVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFSELMVTFRVRPTV
LMPFWNVLGFALGAGTALLGKEGAMACTVVVEESIAHHYNNQIRKLMEEDPEKHEELLQVIKKFRDEELEHHDTGLEHDAELAPAYAVLKSVIQAGCKVAIYLSERL*
81 >lcl|XP_001114462.1|Plus117677224..17678117 NW_001101661 mitochondrial carrier triple repeat protein 1-like isoform 1 LOC716206 __SEG__ Chr15 {Macaca mulatta} MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLH
KHVSAPEFATCGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGL
LGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI*
82 >lcl|XP_001114599.1|Plus1complement(10277107..10278078) NW_001108671 tumor-associated calcium signal transducer 2-like LOC716334 __SEG__ Chr1 {Macaca mulatta} MARGPGLAPPPLRLPLLLLLLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDP
EGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIG
DAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGVAVLVISNRRKSGKYKKVEIKELGELRKEPSL*
83 >lcl|XP_001114734.2|Plus11865110..1866708 NW_001100376 V(D)J recombination-activating protein 2 isoform 1 RAG2 __SEG__ Chr14 {Macaca mulatta} MPSENMSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHLDVKHNHVKLKPTIFSKDSCYLPPLRYPATCTFKGNLESEKHQYIIHGGKTPNNELSD
KIYVMSIVCKNNKRVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLPHVFLVDFEFGCATSYILPELQDGLSFHVSIAKNDT
IYILGGHSLANNIRPANLYRIRVDLPLGSPAVNCTVLPGGISVSSAILTQTNKDEFVIVGGYQLENQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGSNMGNG
TVFLGIPGDNKQVVSEAFYFYTLKCAEEDTNEEQTTFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFDTYNEDDEEDESETGYWITCCPTCDVDINTWVPFYS
TELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD*
84 >lcl|XP_001114854.2|Plus11510..2415 NW_001218964 baculoviral IAP repeat-containing protein 4 XIAP __SEG__ ChrX {Macaca mulatta} MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFADFPSSSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENSATQSTNSGI
QNGQYKVENYLGSRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEH
RRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIITFGTWIYSVNKEQLARAGFYALGKLYYKTNK*
85 >lcl|XP_001114899.1|Plus1complement(23997943..23999181) NW_001112571 transmembrane protein 22-like isoform 4 TMEM22 __SEG__ Chr2 {Macaca mulatta} MDTSPSKQYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEDYGNFMEENPKKGLLSEMKKKGRTFFGTMDTLPPPTEDPMINEIGQFQSFADKNIFQSRKMWIVLFG
SALAHGCVALITRLVSDRSKVPSLELIFIRSVLQVLSVLVVCYYQEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILAFLLVDEKMAY
VDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKEKISMWTALFTFGWTGTIWGISTMFILQEPIIPLDGETWSYLIAICVCSTA
AFLGVYYALDKFHPALVSTVQHLEIVVAMVLQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRRQDYQEILDSPIK*
86 >lcl|XP_001115879.1|Plus13118999..3121053 NW_001102974 signal peptide peptidase-like 2C-like isoform 1 LOC717107 __SEG__ Chr16 {Macaca mulatta} MACLGFLLPVGFLLIISTMARGEYGVAHVVSENWSKDYCILFSSDYVTLPRDLHHAPLLPLYDGTKAPWCPGEDSPHQAQLSSPSQRPLRQTTAMVMTGNCSFHTKGWLA
QGQGAHGLLIVGRVSDQQCSDTTLVPQDPRQPLGDLTIPVAMLHYTDMLDILSHTHGEAIVRVAMYAPPEPIIDYNMLVIFILAVGTVAAGGYWAGLTEANRLQRRRARR
GGGPGGHRQPREAAAAEGAQKEDNEDIPVDFTPAMTGVVVTVSCSLMLLLYFFYDHFVYVTIGIFGLGAGIGLYSCLSPLVRRLPLWQYQNPPHGLWASLPLPLLLLASL
CATVIIFWVVYRNEDRWAWLLQDALGISYCLFVLHRVRLPTLKNCSSFLLALLAFDVFFVFVTPFFTKTGESIMAQVASGPAESSSHEKLPMVLKVPRLRVSALTLCSQP
FSILGFGDIVVPGFLVAYCCRFDVQVHSHLVYFVACTVAYAVGLLVTFMAMVLMQMGQPALLYLVSSTLLTSLAVATCRQELSLFWTGQGRAKMLGLCCAPSAGSRQKQE
GAADAHTASTLERGTNRGAGDLDSNSGEDTTEIVTMSENEATNPEDRSDSSEGWSDAHLDPNELPFIPPGASEELMPLMPMAMLIPLMPLMPPPSELGHVHAQAQAHDTG
LPWAGLHKRKGLKVRKSMSTQAPL*
87 >lcl|XP_001116313.1|Plus124374..25798 NW_001116498 zinc finger and BTB domain-containing protein 9-like ZBTB9 __SEG__ Chr4 {Macaca mulatta} METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRL
PLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGANSYHALLSTTSSTGGWCIRSSPFQTPVQSSASTESPASTESPVGGEGSELGEVLQIQVEEEEEEEEE
DDDEDQGSATLSQTPQPQRVSGVFPRPHGLHLLLVTATPRKLPEGESAPVELPAPPTALPPKIFYIKQEPFEPKEEISGSGTQPGGAKEETKVFSGGDTEGNGELGFLLP
SGAGPTSGGGGPSWKPVDLHGNEILSGGGGPGGAGQAVHGPVKLGGTPPADGKRFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGICNKRFKLKHHLTEHMKTHAGALHA
CPHCGRRFRVHACFLRHRDLCKGQGWPTAHWTYK*
88 >lcl|XP_001116851.2|Plus13438780..3439385 NW_001218097 ras-related protein Rab-9A-like isoform 1 LOC720906 __SEG__ ChrX {Macaca mulatta} MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYAD
VKEPDSFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSCC*
89 >lcl|XP_001117410.1|Plus1551..709 NW_001097910 MORN repeat-containing protein 3-like LOC721310 __SEG__ Chr11 {Macaca mulatta} GYGIQFFGPKEYYEGEWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGDGMLRL
90 >lcl|XP_001117485.1|Plus1229..501 NW_001096478 PHD finger protein 21B-like LOC721362 __SEG__ Chr10 {Macaca mulatta} MAVKPNAKTLSPDLLPQQKCLELKTSLLARQRGTQSSLDRLRALLRLIQGEQLLQVTMATTSPTPLLTGPWTKPSVAATHPTLQHPQGHN*
91 >lcl|XP_001118644.2|Plus1857888..858562 NW_001111307 fumarylacetoacetate hydrolase domain-containing protein 1-like LOC722505 __SEG__ Chr20 {Macaca mulatta} MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQD
ECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETASMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLVSMRFKVE
KPEY*
92 >lcl|XP_002798946.1|Plus118060960..18061685 NW_001098159 pyridoxal phosphate phosphatase PHOSPHO2-like isoform 1 LOC100429653 __SEG__ Chr12 {Macaca mulatta} MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYQKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLK
AASFHDVFDKVFTNPAAFNSSGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEY
SVVVWSSGVDIISHLQFLIKD*
93 >lcl|XP_002799331.1|Plus1<8210213..8210593 NW_001099001 poly(rC)-binding protein 1-like LOC709520 __SEG__ Chr13 {Macaca mulatta} SPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQ
YLINARLSSEKGMGCS*
94 >lcl|XP_002800084.1|Plus118141388..18143421 NW_001101661 zinc finger and BTB domain-containing protein 5-like ZBTB5 __SEG__ Chr15 {Macaca mulatta} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALNSSQNGEEQPAPMSSSMRNNLDQRTPFPMRRLHKRKQSAEERARQRLRPSMDESAISDVTPE
NGPSGVHSREEFFSPDSLKIVDNPKADGMTDNQEDSAIMFDQSFGTQEDAQVPSQSDNSAGNMAQLSMASRATQVETSFDQEAATEKSSFQCENPEVGLGEKEHMRVVVK
SEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNNDDNIPNTTSDCRL
ESEAPYLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVRPMQEVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMIGSPRGGASNFPYYRRIAPKMPVVTSVRS
SQIPENSTSSQLMMNGATSSFENGHPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHS
KTTCLRWQSSNLPSTLL*
95 >lcl|XP_002800123.1|Plus1complement(613639..613989) NW_001101662 histidine-rich carboxyl terminus protein 1-like LOC100426328 __SEG__ Chr15 {Macaca mulatta} MMGLLGSTALVGWITGAAVAVLLLLLLLATCLFHGRQDCDVERNRIAAGGNRVRRAQPWPFRRRGHLGIFHHHHHPGHVSHVPNVGLHHHHPRHTPHHLHHHHHPHPHRH
HPRHAC*
96 >lcl|XP_002800153.1|Plus141302..43155 NW_001101663 kelch-like protein 9-like LOC710804 __SEG__ Chr15 {Macaca mulatta} MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDFI
YTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAAC
RWLRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWRSL
APMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHA
GTVYGGLMYISGGITHDTFQNELMCFDPDTDKWMQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVV
GGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS*
97 >lcl|XP_002800775.1|Plus1complement(4894848..4896872) NW_001104434 kelch repeat and BTB domain-containing protein 6-like isoform 1 KBTBD6 __SEG__ Chr17 {Macaca mulatta} MQSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLAQLKSFYDARQLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESQQT
SVTMHDVDAESFEVLVDYCYTGRVSLSEANVERLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFGHRKLRSQAQSYIAQNFKQLSHMGSIREETLADLTLA
QLLAVLRLDSLDVESEQTVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSSSNSLVSA
AENPPQRLGMCAKEMVIFFGHPRDPFLCCDPYSGDLYKVPSPLTCLAHTRTVTTLAVCISPDHDIYLAAQPRTDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYIL
GGRDPITGVKLKEVECYNVKRNQWALVAPLPHSFLSFDLMVIRDYLYALNSKRMFCYDPSHNMWLKCVSLKRNDFQEACVFNEEIYCICDIPVMKVYNPVRAEWRQMNNI
PLVSETNNYRIIKHGQKLLLITSRTPQWKKNRVTVYEYDIRGDQWINIGTTLGLLQFDSNFFCLSARVYPSCLEPGQSFLTEEEEIPSESSTEWDLGGFSEPDSESGSSS
SLSDDDFWVRVAPQ*
98 >lcl|XP_002801034.1|Plus1complement(16481..17746) NW_001106344 c2 calcium-dependent domain-containing protein 4C-like LOC100424440 __SEG__ Chr19 {Macaca mulatta} MRKTNMWFLERLRGSGENGAARGAGSEAGDKASKGPLYSNVLTPDKIPDFFIPPKLPSGPVEGDGQAALGPSTSEQNLASAAPRQTPRSPRLPAKLAAESKSLLKAATRH
VIQIESAEEWPPEEATDPDPQAQGAMSLPSVPKAQTSYGFTTLAESPHTRRKESLFHSEHGALAQVGSLGAGRRRAAAKANGGDGGPREAGGALMSPGRYFSGGESDTGS
SAESSPFGSPLLSRSVSLLKGFAQDSQAKVSQLRHSVGRHGSLSADDSTPDTSPGSRRRLTRRAPPEPGPESGQARGEHTVHVGPRGSVRLLAEYEAGQARLRVRLLAAE
GLYDRLYDARSINCCVGLCLVPGKLQKQRSTIIKNSRHPVFNEDFFFDGLGPASVRKLALRIKVVNKGSSLKRDTLLGEKELPLTSLLPFL*
99 >lcl|XP_002801093.1|Plus1<186009..187382 NW_001106408 zinc finger protein 358-like LOC707823 __SEG__ Chr19 {Macaca mulatta} TLSPGDPNVDPISPGLTATPQVLATSPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRST
LLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPHCGKAFGQS
SNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVHEGAAAAAAAAAAAAAAAAAGLGLGPGLSPASMMRPGQVSLLGSD
AVSVLGSGLGLSSGTSSGRSSDPGSGPGTLPDPSSKPLPRSRSTPSPTPVESSDPKAGHDAGPDLVPSPDPDPAPSPDPDPVPSPDPNPVSHPDPCSPTGDTVSPALPTG
ESPEWVQEQGALLGPDG*
100 >lcl|XP_002801365.1|Plus1complement(1052571..1053266) NW_001106521 hypothetical protein LOC100425409 LOC100425409 __SEG__ Chr19 {Macaca mulatta} MYMSRLSLPRPSSPLSWPPPPPRASSLPRSLPRSPRLCSRSRSRSRSRSRRRSRSLRWLRRRSRSRSRPFSSGPSGPSGPSSPGGPSSGGASPASEGSAMSPPPPRSSSL
RSRSRRARSRLRLLRRFRSRSLSLLRSLERLRSSLSRLRERLRRSRERERRRSRSLSRSRLRSLRSRSRSRSRSLCGSGEGPGLDEVGRPVWPGSPRDRPRPQDPGRPIL
PLIIAGGVIAA*
101 >lcl|XP_002801494.1|Plus1163574..164092 NW_001106534 zinc finger protein 580-like isoform 2 LOC702901 __SEG__ Chr19 {Macaca mulatta} MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSH
RVSHSDLKPFTCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDPAELAQHVRLH*
102 >lcl|XP_002802210.1|Plus1complement(676..>984) NW_001110531 segment polarity protein dishevelled homolog DVL-1-like LOC722380 __SEG__ Chr1 {Macaca mulatta} AAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPMTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM*
103 >lcl|XP_002802255.1|Plus1434912..437245 NW_001110914 kelch domain-containing protein 7A-like LOC713771 __SEG__ Chr1 {Macaca mulatta} MFPRGAEAQDWHLDMQLTGKVVLSAAALLLVTVAYRLYKSRPAPAQRWGGNAQAEAKEEAEGSGQPAAQEASPRALQRGPRRRRSSKGSEAPQGCSWQNPRGPYVLVTGA
TSTDRKPQRKGSGEELGGQGSDSEQVPPSCRGQEARTAVGGNPDPPHLPRLGSEPHSSPAGLIAAADGTCAGGEPAPWQDGKRPEHPGLGQLEPPHCHHVAPLQGSRDMN
QSWVFTRVIGVSREEPGALQAASDVGLTLHQQEGAPNASYTFSSIARVRMEENFIQKVEGVEPRLKGKVYDYYVESTSQAIFQGRLAPRTAALTEVPSPRTPPGSLGTGA
ASGGQAGDTKGAAERAASPHSGPSPSNRGFSRKESLLQIAENPELQLQPDGFRLPAPPCPDPGALPDSDRSSREPHVHLVAGTNFFHVPLTPASAPQVRLDLGNCYEVLT
LAKRHNLESLKEAAYKVMSENYLQVLRSPDIYGCLSGAERQLILQRRLQGRQYLVVADVCPKEDSGGLCCYDDEQDVWRPLARLPPEAVSRGCAICSLFNYLFVVSGCQG
PGHQPSSRVFCYNPLTGIWSEVCPLNQARPHCRLVALDGHLYAIGGECLNSVERYDPRLDRWDFVPPLPSDTFALAHTATACAKEIFVTGGSLRFLLLRFSAQEQRWWAC
PTGGSKDRTAEMVAVNGFLYRFDLNRSLGIAVYRCSASTRLWYECATYRTPYPDAFQCTVVDNLIYCVGRRSTLCFLADSVSPRFVPKELQSFPAPQGTLLPTVLTLPTP
DLPQTRV*
104 >lcl|XP_002802735.1|Plus126045360..26045809 NW_001112540 disrupted in renal carcinoma protein 2-like LOC100424021 __SEG__ Chr2 {Macaca mulatta} MGSRWSSEEERQPLLGPGLGPGLGASWRSREAAAALPAAVPGPGRVYGRRWLVLLLFSLLAFVQGLVWNTWGPIQNSARQAYGFSSWDIALLVLWGPIGFLPCFAFMWLL
DKRGEGSGSASPRCLLGEPAPARAPGLPATSLGPGIGVV*
105 >lcl|XP_002803010.1|Plus1complement(7528433..7528984) NW_001112571 ras-related protein Rap-2b-like LOC711055 __SEG__ Chr2 {Macaca mulatta} MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVP
MILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL*
106 >lcl|XP_002803766.1|Plus11306377..1306952 NW_001116499 cell division control protein 42 homolog isoform 1 LOC100424807 __SEG__ Chr4 {Macaca mulatta} MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPF
LLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVRYVECSALTQKGLTNVFDEAILAALEPPEPKKSRRCVLL*
107 >lcl|XP_002804766.1|Plus1complement(5727523..5728671) NW_001121149 hypothetical protein LOC100428813 LOC100428813 __SEG__ Chr7 {Macaca mulatta} MLKPKDLCPRAGTRTFLEAMQAGKVHLARFVLDALDRSIIDCRAEQGRTPLMVAVGLPDPALRARFVRLLLEQGAAVNLRDERGRTALSLACERGHLDAVQLLVQFSGDP
EAADSAGNSPVMWAAACGHGAVLEFLVRSFRRLGLRLDRTNRAGLTALQLAAARGHGTCVQALTGPWGRAAAAAAARGSNSDSPPGHPAPAPSPERRRPSPRRLPRPLLA
RFARAAGGHGHGGEAGLAGKNSGRHRAQGSERPELGRSMSLALGAVTEEEAARLRAGALMALPNSPQSSGTGRWRSQEVLEGAPPTLVQAPIGLSPHPEGGPGSGRLGLR
RRSTAPDIPSLVGEAPGPESGPELEANALPVSVPGPNPWQAGTEAVVLRAQR*
108 >lcl|XP_002808531.1|Plus1complement(5824266..5827271) NW_001122911 LOW QUALITY PROTEIN: RNA-binding protein 12B-like LOC698382 __SEG__ Chr8 {Macaca mulatta} MAVVIRLLGLPFIAGPVDIRHFFTGLTIPDGGVHIIGGEIGEAFIIFATDEDARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVGSLSNFI
ESVKEEASNSGYGSSINQDAGFHTNGTGHGNLRPRKTRPLKAENPFLFLRGLPYLVNEDDVRVFFSGLCVDGVIFLKHHDGRNNGDAIVKFASCVDASGGLKCHRSFMGS
RFIEVMQGSEQQWIEFGGNAVKEGDVLRRSEEHSPPRGINDRHFRKRSHSKSPRRTRSRSPLGFYVHLKNLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVM
FKTLKDYNTALSLHKTVLQYRPVHIDPISRKQMLKFIARYEKKRSGSLERDRPGHVSQKYSQEGNSGQKLCIYIRNFPFDVTKVEVQKFFADFLLAEDDIYLLYDDKGVG
LGEALVKFKSEEQAMKAERLNRRRFLGTEVLLRLISEAQMQEFGVNFSLMSSEKMQARSESREPS*PFSFI*LKRPTNILSWCL*KL*TSARGLEATG*LQASPEGFPAA
*QAPSRRLPTLLRGL*VPPRGLQALPRGLQATSGGRLQAAF*GGLQASLGGRFQAPSGG*LQAP*GGGLEEAP*GGLEAAAGGGFQAVSHGGLQAASRGGLQATP*GGLQ
VAPRGRFQAAT*GGLETAPRGGL*AASSGRMEAATRG*LQAAPRGGFQAFP*GGLQAVTPGAFPEATSGAFPSATRRAFPETTSRAF*AASPRALPAATPRAFQAPTPRT
FQAPTPRALPETAPGAFQAAASGAFQALPRGRFQAPTR*RLQGPS**RL*APS**GLQEPPGGRF*MPF**RLQAAPRGRP*GSSGGGP*TS*QFQTSW*GF*EPA**F*
KSPPFCEFWSSRRWQV*FWKA*YGKFS*GEIYA*SKDKLWFR*SNSY*DNESSI*S*C**NFRLFPWLQNHT*FSFNTV**ARLTYRRSHCCYDKL*RSYGCY*RSKR*A
SWAPKS*VNFAV