SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom R    

ID / Description / Sequence
1 >lcl|XP_001362123.1|Plus1complement(11777..12100) NW_001581939 EF-hand domain-containing protein D2-like LOC100009730 __SEG__ Chr4 {Monodelphis domestica} MATDELATKLNRRLQIEDGGEGSDHEQGQEPGLNGAAAGPGPGAPDESGDPLASADCELSAKLQRRADLNQGIGEPMSPSRRIFNPYTEFKEFSRKQIKDMEKMFKQ*
2 >lcl|XP_001362127.1|Plus1complement(520463..521035) NW_001581962 cell division control protein 42 homolog LOC100009767 __SEG__ Chr4 {Monodelphis domestica} MRTIKCVVVGDGSVGKTCLLISYTTKNFPSGYLPTVFNYAFTVMIGPESYNLGLFDTAGRNDYELLRPLNYSQTDVILVCFSVVSRSSFENVKKKWVPEITRYCPKTPFL
LVGTKTDLREDASTLTALAKRKQKLIALETAEKLAREVKAVKYMQCSALTKKGLNDVFEEAIRAASKPWEQKKSFRCVLL*
3 >lcl|XP_001362359.1|Plus1475465..476205 NW_001581882 EF-hand domain-containing protein D1-like LOC100009913 __SEG__ Chr2 {Monodelphis domestica} MASYELALKLQRRLRLEQEAEGVPTPQQNGFDRVPAPAWPCGSPSPGDEPPAKELTANAGSELKEQLNRHQGIHEGTARPRPIKVFKPYTEFREFSRRQIKDMESLFRRY
DSGKDGYIDLMELKLMMEKLGAPQTHLGLKEMIREVDEDLDSKLSFREFLLIFRKAASGELEEDSGLMSLAKLSEIDVAMEGVKGAKNFFEAKVHALSVTSRFEAEIKAE
QNAQKQEEDRKHRRALFRERQAAFSQ*
4 >lcl|XP_001362416.1|Plus1complement(368322..368999) NW_001582020 CD9 antigen-like LOC100009865 __SEG__ Chr8 {Monodelphis domestica} MTPDEDDGGNRCIKYLLFGFNAIFCLTGMTIFAFGLWLKFDTRTRTIFDQEDNSQFYTRVYIMIGTGVLMLLMSFLLCCGVMEESQCKLSVFFAFLLVLFAINIVIAIWG
YFNKDKVIREVQAFYKDVYMKMRVKENPYKSILKALHKALDCCGLTGALDVFITETCPVKDFFSSLSMKSCPRAIEEILSSKFHVIRAVSTGIAVLIIFGMVLSLQLCRN
IEDDF*
5 >lcl|XP_001362464.1|Plus1complement(14359503..14360495) NW_001581990 BTB/POZ domain-containing protein KCTD12-like LOC100010822 __SEG__ Chr7 {Monodelphis domestica} MALADSTRGLPNGGGGGGGSGSSSSSSEPPLFPEIVELNVGGQVYVTRRCTVVSVPDSLLWRMFSQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPER
SRLQREAEYFQLPELVRRLGAPQQPGPGPPPPHSRRGVYKEGSVGGGGDELLPLGYLDPEQQEGASAGAPSPTLDLASRSPSGGAGGPLLTPSQSLDGSRRSGYITIGYR
GSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGETLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE
*
6 >lcl|XP_001362670.2|Plus1482034..482600 NW_001581966 GTPase KRas-like LOC100009992 __SEG__ Chr5 {Monodelphis domestica} MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIQRVKDSEDVP
MVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKCIIM*
7 >lcl|XP_001362941.1|Plus1complement(8031295..8032152) NW_001581839 pleckstrin homology domain-containing family F member 1-like LOC100012395 __SEG__ Chr1 {Monodelphis domestica} MVDHLVNTEINSQRIAAVESCFGTSGQPLALPGRVLLGEGILTKECRKKAKPRIFFLFNDILVYGSIVINKRKYSSQHIIPLEEVTLETLPDTWHAKNRWMIKTSKKSFV
VSAASLTEREEWIRHIEECVRRQLRATGRPPTTEHAAPWIPDKATDICMRCTQTKFSALTRRHHCRKCGFVVCGDCSRERFLMPRLSPKPLRVCGLCYRELAAEKQKEEE
GEEELEGQTQPQQDLAHSPGTTYGVSSGEDESDKSDEDKDGGSSGSWPMGLEFYATGVKWSSFHS*
8 >lcl|XP_001363049.1|Plus111910494..11911276 NW_001581926 BTB/POZ domain-containing protein KCTD21-like LOC100017978 __SEG__ Chr4 {Monodelphis domestica} MSDPITLNVGGKLYTTSLSTLTSFPDSMLGAMFSGKMPTKKDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNA
MLNITLNKRVQNIHFTVREAPQIYSLSSSDMEVFNANIFSTSGLFLKLLGSKLFYCFNGNLSSISSYLQDPNHLTLDWVASVDGLPEEEYTKQNLKRLWVVPANKQINSF
QVFVEEVLKIALSDGFCVDSSHPHLSDFMNNKIIRLIRYR*
9 >lcl|XP_001363254.1|Plus11253406..1255409 NW_001587043 transcriptional regulator Kaiso ZBTB33 __SEG__ ChrX {Monodelphis domestica} MESRKLISATDIQYSGNLLNSLNEQRDHGLFCDVTVIVEDRKFRAHRNVLSASSTYFHQLFSVAGQVVELNFLRAEIFAEILNYIYSSKLMRIRSDLLDEIIKSGQLLGV
KFIAELGVPLSQVKSISGSIKPDSGETLSGTDENGLQMQKAENEGSDAGVTMMPVITETFSLCAEDYETKKIGTDSDEDDDVIFCSEILPPKEGLPGSTSVAQVQPDPEP
VAYADKACGTSSSPPLTNKPLQTLATSVSQTVPSQTRNSEETLKSAAPKHLTPNIILLNQPSLNSMPSSSHPSQMSPAVNLLVQNHPQIPNNATALPKHRTNVDMEAEII
DDDDDTISSSPDSGVSNTSLVPHPDTQKNVSFNGSAIQSKQVSLFHQEPLSNSLKISNVITESSKDSGGGSKHVMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIV
IPVKDDPDEKEAKHDNEVPKTSGDEPSNKRVKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLTC
GKSFINYQFMSSHIKSVHSQDPSGDTKLYRLHPCRSLQIRQYAYLTDRPRSIPVIKEDGIVYKVDGKEPSEGTATSTPQNKPMTWDDIFIQQGNDSMFKQNVTDGSTEFE
FIIPESY*
10 >lcl|XP_001363346.1|Plus12616764..2617390 NW_001581961 ras-related protein Rab-18-like LOC100010335 __SEG__ Chr4 {Monodelphis domestica} MEEDVLTTLKILIIGESGVGKSSLLLRITDDTFDPNISATIGVDFKVKTISFDGNKAKLAIWDTAGQERFRTLTPNYYRGAQGVILVYDVTRRDTFVKLDNWLIELNTHC
MGNDITKMLVGNKIDKENHEVDRNEGLKFARKHSMLFIEVSAKTCDGVRCAFEELVEKIFQTPGVWEIKNQKKGVRLSQNEESPGRVCGGCFSMLYRL*
11 >lcl|XP_001363461.1|Plus1complement(8636150..8637919) NW_001581896 ectoderm-neural cortex protein 1-like LOC100011601 __SEG__ Chr3 {Monodelphis domestica} MSVSMHENRKSRASTGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQSSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTISKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLSKRHCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEQYDPVTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
12 >lcl|XP_001363634.1|Plus1complement(16090416..16092446) NW_001581976 zinc finger and BTB domain-containing protein 5 ZBTB5 __SEG__ Chr6 {Monodelphis domestica} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFTVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSDRVQEQNARMQRSFMLQQLGLSIVSSALNSSQSTEEQQTTMNLSMRSNIEQRTTFPIRRFHKRKQSSEDRARQRMRPTLDESMISDVTPE
NGQAVVHSREEFFSPDSLKIVDNSKSDSVTDNQEDNAIMFDQSFNGQEDAQMPSQSDNTAGNISQMSMASQATQVETSFDQEATSEKNGFQCENTEVGLSEKDHMRVVVK
SEPLSSPEPQDEVSDVTSQAEGSESVEVEGGVVSAEKIELSPESSDRSFSDPQSSTDRVGDIHILEVSNNLEHKSTFSISSFLNKSRSSTFSANQNNDDNIPNTTSDCRM
DNDTSYLMSPESGPTSGHSSAAVSHVENPFSEPADSHFVRPLQEVMGLPCVQTSGYRAAEQFGMDFPRSGLGIHSLSRAMMGSSRGGASNFPGYRRIAPKMPVVTSVRSS
QIQDNSANSQLLMNGPTSSFENGHPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSK
TTCLRWQSSNLPSTLL*
13 >lcl|XP_001363693.1|Plus123687642..23689201 NW_001581901 ankyrin repeat domain-containing protein 34B-like LOC100012401 __SEG__ Chr3 {Monodelphis domestica} MDEAVEVSTDGNSLIKAVYQSRLRLTRLLLEGGAYINESNDRGETPLMIACKTKHIDHQSVSKVKMVKYLLENNADPNIQDKTGKTALMHACLEKAGPDIVSLLIKSGGD
LSLQDHSGYSALVYAINSEDRDTLKVLLNACKAKGKEVIIITTAKSPSGRHTTKQYLNVPPGDMEGFHSPTSCTTPSEIEIKTASSPRSNSSEMEKGLFGFKDLDLSGSS
DDASEPGSPTRRPTAVPSGPKLGQAQHLHSDPWVKSSPSLLHLGKVASFQEELQDITPEEEFSLKTNGLALSKRYITRHQSIDVKDAAHLLKVLEQVGSRKLSYEEILSQ
PLFSEGSQPCNDVLVDQDPESTAQTMFVSTLKNIVQKRTSGANHYSSDSQLTTSLTPATAEDGKTFAGKKKILSPSPPGLAGSKELPENGPPGPLSRRNHAMLERRGSGA
FPLDHTSQTRPGFLPPLNVNSHPPLLDIGVSNKISSLFSCGQKMIMPTVPTFPKEFKSKKMLLRRQSLQTEQIKQLVNF*
14 >lcl|XP_001363707.1|Plus19766786..9768201 NW_001581965 heterogeneous nuclear ribonucleoprotein K-like LOC100012358 __SEG__ Chr5 {Monodelphis domestica} METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEE
GLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKG
RAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPG
DRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQVEYHEFTGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDR
IITITGTQDQIQNAQYLLQNSVKQYADVEGF*
15 >lcl|XP_001363716.1|Plus110172069..10172350 NW_001581988 HIG1 domain family member 1A-like LOC100014463 __SEG__ Chr7 {Monodelphis domestica} MSSDSDASLSTYDESSGSKFARKAKEAPFVPIGIAGFAAIVAYGLYRLKGRGHTKMSVHLIHMRVGAQGFVVGAMTVGMLYSMFQEYWAKPKP*
16 >lcl|XP_001363783.1|Plus1complement(6949861..6950436) NW_001581928 rho-related GTP-binding protein RhoG-like LOC100013591 __SEG__ Chr4 {Monodelphis domestica} MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSTVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWYPEVCHHCPDVPI
LLVGTKKDLRAHPDALRRLKEQGQAPITPQQGVALSKQIHAVRYLECSALQQEGVKEVFAEAVRAVLNPTPLKRGRSCFLL*
17 >lcl|XP_001363834.1|Plus1545824..546216 NW_001581946 nanos homolog 2-like LOC100010596 __SEG__ Chr4 {Monodelphis domestica} MQLPAPFDMWKDYLNLNKILWEVISGQGGPGGGERGQQEAEAGQERQVVAGGPLCNFCKHNGESRHVYTSHLLKTPEGIVVCPILRHYVCPLCGATGGLAHTLKYCPLNG
GQQSLYRRSGRNSAGRKVKR*
18 >lcl|XP_001363931.1|Plus18560401..8560982 NW_001581835 transforming protein RhoA-like LOC100012776 __SEG__ Chr1 {Monodelphis domestica} MAAIRKKLVVVGDGACGKTCLLIVFGKDQFPGVYMPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPGSLVNILTKWAPEVKNFCPNV
PVILVGNKKDLRNDQHTKEELAKKKQEPVKTEEGRDMANQIGAIGYIECSAKTKDGVRQVFEMATRAALQVRRKSKRSGCLVL*
19 >lcl|XP_001363980.1|Plus1complement(7740315..7741091) NW_001581993 BTB/POZ domain-containing protein KCTD4-like LOC100012200 __SEG__ Chr7 {Monodelphis domestica} MERKINRREKEKDYEGKHNSPEGTDQGKSCKTLTTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPLDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLA
QEAEFFQLKGLAEEVKSRWEKEQLTSRETTFLEITDNHDRSQGLRIFCNAPDFITKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFIKSENGTRLVLKEDNTFVCTLE
TLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK*
20 >lcl|XP_001364027.1|Plus1complement(2410730..2412220) NW_001581881 ankyrin repeat domain-containing protein 34A-like LOC100013084 __SEG__ Chr2 {Monodelphis domestica} MLHAEGHALLRAVGQGKLRLTRLLLEGGAYVNEGDAQGETALMAACRARYDDPENRARMVRYLLEQGADPNIADRLGRTALMHACAGGGGAAVATLLLAHGADPSARDHA
GASALVHALDRGDRETLSALLEACKAKGTEVIIITTDTSPSGTKKTRQYLNSPPSPGVEDPPTPVPTPGVCMSPSEIQLQTGGGGKGVLSPRAQEEEEKRDVFEFPLPKP
PDDPASSDPLPKPPRHPPPKPLKRLNSEPWGLVAPPQPLPPAEGRPATDRLIAEFNGLALTSRPRLSRRHSTEGPEEPPPWAEKVTGGGALSRRNTAPEAQESAPLPGLK
QKLSRMEPVELDGPGHLCPDSPDSSRLSLERRRYNASPLTLPSASSVTSPGQSQESLPGAVSPLSGRRRSPGLLERRGSGTLLLDHISHTRPGFLPPLNVSPHPPIPDIR
PLPGCRAPSLPAPHHSGGLGSPRTKRKLVRRHSMQTEQIRQLGGFQSLGGPGEQGR*
21 >lcl|XP_001364074.1|Plus11478615..1479361 NW_001581840 haloacid dehalogenase-like hydrolase domain-containing protein 3-like LOC100010709 __SEG__ Chr1 {Monodelphis domestica} MAPRLQLLTWDVKDTLLRLRHPVGKGYAAEAQAHGLKVEAAALESAFHQAYKVQNQKFPNYGLSQGLTSQQWWLDVVLQTFHLAGVQNSNILDSIANKLYKDFSSAKTWQ
LLEGAESTLRQCRERGLRLGVVSNFDRRLEDILAHYGLLEHFDFILTSEAAGRAKPDPQIFRQALQLADVEPTQAAHIGDHYLNDYQAPREVGMYSFLLMGTKPQDPFPG
TIPKEHILPSLPHLLVALNHLEGPDPKQ*
22 >lcl|XP_001364107.1|Plus114941550..14942614 NW_001581879 membrane progestin receptor beta-like LOC100013708 __SEG__ Chr2 {Monodelphis domestica} MTTAILERLSTLSVSGQQLRRLPKLLEDGFPKMPCTVPESDVPQLFREPYIHTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFRAFAETEALPWTSAHSL
PLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDPAWYERFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKVCQVVPAGLA
FVLDISPVAHRVALCHLSGCQEQAAWYHTLQIFFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAILLDYQGRQEIFLQRHSPLSVYLACLSFFLL
AACSGTTAAFLRRKIKAGLTKKDS*
23 >lcl|XP_001364146.1|Plus13231443..3232021 NW_001582023 cell division control protein 42 homolog LOC100012700 __SEG__ Chr8 {Monodelphis domestica} MMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGSNPHTLGLFETAGQEDYDRLRPLSYSQTDVFLVCFSVVSPSSFQNVRQKWVPEITHHCPKTP
FLLVGTQIDLRENPFALETLAKKKQKPVTAEIAEKLTRDLKGIKYVECSALTQKGLKNVFDEAILASLDPPKPKKGHKCVLL*
24 >lcl|XP_001364182.1|Plus115185852..15186907 NW_001581872 protein Tob1-like LOC100012985 __SEG__ Chr2 {Monodelphis domestica} MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGDKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVK
VLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPTNLGLNVNDLLKQK
AISSSMHSLYGLGLGGQQQPQQQQQQQQQQQQQQQQQQQPSQQQQQQQQKTSALSPNAKEFIFPNMQGQGSNNGMFPGDSPLNLSPLQYSNAFDMFAAYGGLNEKSFVDG
LNFSLNNMQYSNQQFQPVMAN*
25 >lcl|XP_001364423.1|Plus1complement(1292182..1292781) NW_001581894 GTP-binding protein Di-Ras2-like LOC100014875 __SEG__ Chr3 {Monodelphis domestica} MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSQQSLEELKPIYEQICQIKGD
VESIPIMLVGNKNDESSNREVQSSEAEALAKKWKCAFMETSAKMNHNVKELFQELLNLEKRRSVSLQIDGKKSKQQKRKEKLKGKCVLM*
26 >lcl|XP_001364502.1|Plus1complement(17864759..17865256) NW_001581902 UDP-N-acetylglucosamine transferase subunit ALG13 homolog LOC100012443 __SEG__ Chr3 {Monodelphis domestica} MKSVFVTLGTTSFYELVVCVSSRAMLQNLRRLGYRKLVLQIGKGRVVPDSFASTTFSLIVYKYKNSLKEDIKRADLIISHAGAGSCLEALEEGKPLVVVVNEKLMDNHQL
ELARQLHKEGYLFYCSCSTLLELLSSVDLSSLRLFPPGKPEMFSEVLDKVVGFEK*
27 >lcl|XP_001364634.1|Plus14123913..4124194 NW_001581898 HIG1 domain family member 1A-like LOC100014038 __SEG__ Chr3 {Monodelphis domestica} MSSDSDVSLSTYDESSGSKLARKAKEAPFVPIGIAGFAAIVAYGLYKLKSRGNTKMSVHLIHMRVGAQGFVVGAMTVGMLYSMFWEYWAKPKP*
28 >lcl|XP_001364763.1|Plus1204084..205853 NW_001581861 ectoderm-neural cortex protein 2-like LOC100013826 __SEG__ Chr1 {Monodelphis domestica} MSVSVHENRKSRTSTGSMNITLFHKPSHPDCVLSHLNTLRKHRMFTDVTLWAGDRSFPCHRAVLAASSCYFEAMFSHGLRESLDDAVNFHDSLHPEVLELLLDFAYSSRI
IINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYELSWRMCLVHFETVQQSEDFKNLSKDTLLDLISSDELETEDERVVFEAIIQWVKH
DLDGRKVYLPELLRSVRLALLPSEILKEAIACEDLIMADERNKLIMDEALHCKKKILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSACAIGCKVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTAVAGVFPASPSVSLKQVEKYDPGANKWTMVAPLRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCYDPADNRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWTCITTVPYSLIPTAFVSTWKHLPA*
29 >lcl|XP_001364847.1|Plus1complement(5284395..5284991) NW_001581906 GTP-binding protein Di-Ras1-like LOC100014777 __SEG__ Chr3 {Monodelphis domestica} MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELRPIYQQILQIKGS
VENIPVMLVGNKCDETQREVDTKEGEALAKEWKCAFMETSAKMNYNVKELFQELLTLEKHRNMSLSIDGKRSSKQKRTDKLKGKCSLM*
30 >lcl|XP_001364867.1|Plus1complement(27358584..27359189) NW_001581988 ras-related protein Rab-9A-like LOC100017732 __SEG__ Chr7 {Monodelphis domestica} MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFESQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLGNWKKEFIYYAD
VKEPESFPFVILGNKIDINERQVSTEEAQAWCRDNGNYPYFETSAKDATNVAAAFEEAVRRILATEDRSDHFIQTDTVNLHRKPKPSSSCC*
31 >lcl|XP_001365075.1|Plus131649391..31650629 NW_001581960 transmembrane protein 22-like LOC100016707 __SEG__ Chr4 {Monodelphis domestica} MDTSPSKKYPVKKRVKIHPNTVMVQYTSHYPQPGDSGYEEINEDYGSFMEENPKKGLLSEVKRKGRTFFGAMDSRTPPTEDPKANETEQFRSFADRNIFQSRKTWIVLFG
SALAHGCVALITRLVSDRSKVPSLELIFIRSVLQVFSVLVVCYYQDPPFGPRGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILAFLLVDERMAY
IDMATVVSSILGVCLVMIPNIVDEENSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIREKISMWTALFTFGWTGTVWGVSTMFILQEPIIPLDGETWGYLIAICICSTA
AFLGVYYALDKFHPALVSTVQHLEIVVAMILQLLVLHIFPSVYDVFGGAIIMISVFVLAGYKLYWRKLKREDYQEILDSPIK*
32 >lcl|XP_001365449.1|Plus11291139..1291804 NW_001581981 fumarylacetoacetate hydrolase domain-containing protein 1-like LOC100011508 __SEG__ Chr6 {Monodelphis domestica} MAAPRQLPRFWEWGKNIVCVGRNYADHVKEMKSTVLTEPVIFLKPSSAYAPEGTPILIPSYSRNVHHELELAVVMGKPTCAVSELEAMDFVAGYALCLDMTARDVQDDCK
KKGLPWTLAKSFTSSCPVSKFVPKEKIPDPHKLKIWLKVNGQLRQEGETSNMIFSIPYIISYVSKIIALEEGDIILTGTPKGVGPVHENDEIQAAIDGIVSMSFKVEKSK
Q*
33 >lcl|XP_001365544.1|Plus1complement(1908788..1910839) NW_001581929 ubiquilin-3-like LOC100020316 __SEG__ Chr4 {Monodelphis domestica} MAKSGEVPPRASPASTTDPHIIKVTVKTPKDKEEFAVQDTCTIQQLKKEISQRFKAHPDQLVLIFAGKILKDPDSLVQCGIRDGLTIHLVIKMQKRGGGPECLAPSQPAL
PPPPPPPPPPVPLHPGGAHPFSLGVLTGLNGLGLTSGSFPDLQSQLLWQHISVPELVAQIIDDPFIQGLLSNTGLVRQLVLDNPYMQQLIQHNPEIGHILNNPEIMRQTL
EFLRNPAMMQEMMRSQDRALSNLESIPGGYNALRTMYTDVMDPMLNAVQEQFGGNPFAAAATTSSATNSGCSQPSRTENCDPLPNPWATHYGITAGGQDRQHGGQDSRHI
PLRSDPQEGSPGFPSIGLTGYLQQLLEPPQGLGAYLQGPASLGLSQEPSPTTLSGGHAPPAVPPAQQSGARQSLPKEPLAVKTKTTCPAFLRPPTTSSSKRGSDKEDGSV
GPKGHSTNMPNLVSGLTATSGDGFMTSSTAPVAGPPQAPEPAWMARPTYVRPPRTVPMDTSTRGALQFQEEMQRQLPLLVHLQAAMANPRALQALLQIENGLQTLATEAP
RLLLWFSPSLGVLGIPSFMPGAEMGSCPLNNPTSVVNPEECPETVARTVSSGQGLAEVESLSDPFFQMLQVLTNTGPQLQSSPLQQPEAQFQPQLEQLHAMGFLNPEANL
QALIATEGDVDRAVEKLRESQIS*
34 >lcl|XP_001365605.1|Plus12869603..2871144 NW_001581916 WD40 repeat-containing protein SMU1-like LOC100018946 __SEG__ Chr3 {Monodelphis domestica} MSIEIESSDVIRLIMQYLKENHLHRALATLQEETTVTLNTVDSIESFVADINSGHWDAVLQAIQSLKLPVKTLIDLYEQVVLELIELRELGAARSLLRQTDPMIMLKQTQ
PERYIHLENILARPYFDPHEAYPDGSSKEKRRAAIAQALAGEVSVVPPSRLLALLGQALKWQQHQGLLPPGMTIDLFRGKAAVKDVEEEKFPTQLSRQIKFGQKSHVECA
QFSPDGQYLVTGSVDGFIEVWNFTTGRIRKDLKYQAQDNFMMMDDAVLCMCFSRDSEMLATGAQDGKIKVWKIESGQCLRRFERAHSKGVTCLSFSKDNSQILSASFDQT
IRIHGLKSGKTLKEFRGHSSFVNEATFTQDGHSIISASSDGTVKIWNMKTTECTNTFKSLGSTAGTDITVNSVFLLPKNPEHFVVCNASNTVVIMNMQGQIVRSFSSGKR
EGGDFVCCALSPRGEWIYCVGEDFVLYCFSTETGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP*
35 >lcl|XP_001365654.1|Plus1complement(17156730..17157368) NW_001581859 sentrin-specific protease 8-like LOC100013705 __SEG__ Chr1 {Monodelphis domestica} MDPVVLSYMDSLLRESDVSLLDPPSWLNDHIIGFAFEYFASDQFHDCSDQVCFISPEVTQFIKCTTSPEEITMFLQPLDLPHKRVVFLPINNNSNQAAGGTHWSLLVYHQ
DKNRFSHYDSHSRSNSVHARQVAGKLEAFLGKRGDKVAFVEEKAPAQQNSYDCGMYVICNTEALCQGFFKGQPEPRLQHLTPMYITRKRAEWKDLISKLARK*
36 >lcl|XP_001365667.1|Plus11936266..1938287 NW_001581904 protein fem-1 homolog A isoform 1 FEM1A __SEG__ Chr3 {Monodelphis domestica} MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEPAAGAAGAAAGGPAAGGTPLLIAARYGHLDVVEYLVDRCGASVEAGGSVHFDGETIEGAPPLWAASAAGHLGV
VQSLLRRGASVNRTTRTNSTPLRAACFDGHLDVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCKAR
MERDGYGMTPLLAASVTGHTNIVEYLIQEQPAPEVQVQPKLLQREEEEESTAAGPSTSSGPEEAQSPEPYESCCPTSREAAVEALELLGATFVDKKRDLLGALKYWRRAM
ELRHQGGEYLPKPQPQQLVLAYDYSREVNTPEELEALITDPDEVRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIHLWKYALDMQQNNLEPLSPMTASSFL
SFAELFSYVLQDRTTKGSLGTQIGFADLMGVLSKGVREVERALQHPKDPGDSSQFTKALAIILHLIYLLEKVECTPEQEHLKRQTVYRLLKCSPRGKNGFTPLHMAVDKD
TTAVGRYPVGKFPSLHVVNVLLECGADPDSRDFDNNTPLHIAAQNNCPLIMSALMEAGAHMDATNAFKKTAYELLDEKLLSKSTMQPFNYITLQCLAARALDKHKVPYKG
FIPEELEAFIELH*
37 >lcl|XP_001365764.2|Plus1complement(6926721..6928040) NW_001581969 RNA-binding protein 42-like LOC100011701 __SEG__ Chr5 {Monodelphis domestica} MAGTGPLPGGGEAVPSGPGPGVPGKSGEERLKEMEAEMALFEQEVLGAPMSGIPAPLVPAVEPAPVLRPIIATNTYQKVQQSLEARAAAAATVIAPIVAPPGPFVSPVGF
GPGGDRSRLDSSEARDAMFLHLAAGGPRPMALRLPHQALVGPPLPGPPGPPMMLPLMARAPGPPIGTMVTLRPPPEEPPAPRELDLGLGLKEKEEAAAAAVAVVAASAAA
TSGLEEVAVGGPGATTIIGPSLPLPLAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPRPEPQPPPGLMALEVSEPLGEDKKKGKPEKLKRCIRTAAGSSWEDP
SLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR*
38 >lcl|XP_001365791.1|Plus1complement(4626887..4628428) NW_001581916 WD40 repeat-containing protein SMU1-like LOC100020550 __SEG__ Chr3 {Monodelphis domestica} MFIEIESSDVIRLIMQYLKENHLHRALATLQEETTVTLNTVDSIESFVADINSGHWDTVLQAIQSLKLPVKTLIDLYEQVVLELIELRELGAARSLLRQTDPMIMLKQTQ
PERYIHLENILARPYFDPHEAYPDGSSKEKRRAAIAQALAGEVSVVPPSRLLALLGQALKWQQHQGLLPPGMTIDLFRGKAAVKDVEEEKFPTQLSRHIKFGQKSHVECA
QFSPDGQYLVTGSVDGFIEVWNFTTGRIRKDLKYQAQDNFMMMDDAVLCMCFSRDSEMLATGAQDGKIKVWKIESGQCLRRFERAHSKGVTCLSFSKDNSQILSASFDQT
IRIHGLKSGKTLKEFRGHSSFVNEATFTQDGHSIISASSDGTVKIWNMKTTECTNTFKSLGSTAGTDITVNSVFLLPKNPEHFVVCNASNTVVIVNMQGQIVRSFSSGKR
EGGDFVCCALSPRGEWIYCVGEDFVLYCFSTETGKLERTLTVHEKDVIGIAHHPHQNLIATYSEDGLLKLWKP*
39 >lcl|XP_001366295.1|Plus11100578..1102347 NW_001582005 kelch domain-containing protein 7B-like LOC100012096 __SEG__ Chr8 {Monodelphis domestica} MVLRSHPFPSSAKRQGEAPQTGPVDRSSAAAEPSRSSQTRDLPPGVSAVGTEPQATVRDQPLSAGMETPAATTPSSSRGLNGAPVEEKRPATTEPPRVTRGPSSPPGPPP
ERKQQEPTVPRETRPEGQPAPRPRKRSICQMADSLAQRAGPAAPPQRESPPGMVTPLTERQLQDSQLMAFLRRPGTWGRAEGPRKPSHPPKDLAGAVAAVRRHLDLGSCV
AALAFAQQHGELALAEEVYALMSDNFLLVLGDAPLYRQLSGGDRERILALRKTRGRPVLGLLVLPSVYGVSRSALAGEPQATEVPATPSAGVPRTYLYTFEPGRNAWQPL
TLVPEEAPLRGCGLCTMYNYLFLAGGVRGSGPAAVSTNEVFCYNPLTDIWSPVRPMLQARAQLKLVALEGLLYAIGGECLYSMECYDPRTDHWASRASLPEGTFPVAHEA
VACRGDIYVTGGHLFYRLLKYSPAQDSWAECPYSASHRRSSDMVALGGFLYRFDLLRGVGAAVMRYNTVTGSWSQAAPLPLPEPLPLRCAVLANTIYCLNQQVTATFTVS
EGTAQFEARQLKPFPLGGRGALCPFTLTLPTSSPLQTPL*
40 >lcl|XP_001366470.2|Plus1complement(647253..648152) NW_001587040 ankyrin repeat domain-containing protein 54-like LOC100012228 __SEG__ ChrX {Monodelphis domestica} MAWEPRTEGGATARAPRAARLWEPRAEGGARSEGSFSFGEFAAVLGGLGTAAPTPPAAPAPPPLRLLHELWQQDPSPSELRKGKLRPGRLRLAARPHRRLGPTGKEVHDM
KRLREAANTNDIDTAQQLLDDGVDPRAIDDKGRTALHFAACSGSDQIVQLLLDHGADPDHRDGLGNTALHLAACTNHVPVITTLLRRGARVDVLDRAGRTPLHLAKSKLN
ILQEGHPQCLEAVRMEVKQIIQMLKEYLERLGQHEQRLRLDDLCNRLQMTSTKEQVDEVTDLLASFTSLRLQVQKLGRR*
41 >lcl|XP_001366661.1|Plus1complement(25512279..25513481) NW_001582018 f-box/LRR-repeat protein 14-like LOC100017399 __SEG__ Chr8 {Monodelphis domestica} METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGH
AFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSL
KHISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGINRMVRQMH
GLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTESEKVR*
42 >lcl|XP_001366786.1|Plus1complement(963540..964967) NW_001581972 zinc finger and BTB domain-containing protein 3-like LOC100012474 __SEG__ Chr5 {Monodelphis domestica} MEFPGHSEQLLQSLRDQRSQGFLCDCTVLVGSTPFQAHRAVLASCSPFFQLFYKERELDKRDLVCIHNEIVTAPAFGLLLDFMYAGQLALRGDTPVEDVLAAASYLHMND
IVKVCKRRLQARGLAEADSTKKEEESRAPRTTPEPLPSTSRGLLPVLPLQETPGWRDQNQWKAPAPALPSGPHAEEPPGPEGADTTQPGIDAPVAEGSHSSPTSSTEAVP
TGYFSPSLGAAPGEPPAPLEVGPENLGVVGPRGPSGPMEGFYPPPPVPVPVPAPGEAEPVQVKVEAIVISDEEPEGLEERPRAPEGLFPPGSGCRSRYAPAEAFEEAAVT
AASGAGGPGLEEVGPADHFLAPDSHLPYHLLAGPGHYHPGLVTPPPPAPSSLHESLYLPPEYEVAPGGFGVFTEDVPTCKTCGKTFSCSYTLRRHATVHTRERPYECRYC
LRSYTQSGDLYRHIRKAHNEDLAKRSKQDPEAAPS*
43 >lcl|XP_001367115.1|Plus141290477..41291040 NW_001582021 GTPase NRas-like LOC100019037 __SEG__ Chr8 {Monodelphis domestica} MTEYKLVVVGAGGVGESALTIQLIQNHFVDEHDPTTKDSYRKQVVIDGETCLWAILDTSGREECSAVRDQYMRTGEGFLCVFAINNSKSFADMNLYKQPLKERKTDDVPR
VLMGNKCDLPTRTADTKQAQELAKSYGIPFIETSAKTRQGVDAFYTLVREIRQYCMKKLNSSNNGTQGCPGFSWAVM*
44 >lcl|XP_001367498.1|Plus111356713..11358668 NW_001581957 kelch-like protein 34-like LOC100013107 __SEG__ Chr4 {Monodelphis domestica} MSYFLSYCKAHGGAILTHYQLLRDEGFLCDVKLEAEGSEFLAHRSLLACSSDYFKALFKSYTQESQAPVIRLQVPSATGLQRLLDFIYTAWLPLSMDTLEDTLEAASYLQ
VSEAVGLCSRYLVRHLGLENCCFAANLASRFGLADALPEAESFIGRHMRELLDRGLEAAGLLELNSGSLRAVLGSSDVPFVAEVRLLNLALSWLQREPAAERLPQCCSLL
ERIRFGLVPPEVLRRVYSGSGLNLPARVKGLIIQALSYHTATSRQPLMQSEQTSCRSPKTRILLVGGRRAREAATQSTEDAQIAQQEDAGGVGGVVEEQAEEEVRPEEAD
DWKLTQDVVSFDVYNHRWRSLTRLPAPLQGHCVCTIGSFLYVLGGETPAGSSSSLFPTVPLEVTAQVHRYDSHFHRWASIPTMKEARAHFWCGAVGDSLLAVGGVGADGA
ALASVEIYDLGRDRWTAARELPQPVYGHAGAVGTCGTVYISGGKLGGRPVDGSLGRGGSIRDVYALSPREKVWSKRAPMSIARFGHHMATLRGAVFAFLGRYELFSEIER
YDPGADQWTRLRPLLYDRFCYGLAVVEETALLLGGLKWQDSRQVPTRNVVGYDLDLDCWEDIGCDMPQAWNGLKCAVLQLAEEEEESVEKTKKVETQAEVH*
45 >lcl|XP_001367554.2|Plus1complement(122709..123284) NW_001587053 rho-related GTP-binding protein RhoG-like LOC100013158 __SEG__ ChrX {Monodelphis domestica} MQTIKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQMSVDGRTVSLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIGSPSSYANVRHKWHPEVSHHCPNVPI
LLVGTKKDLRNDLATLKRLKEQSLTPTTPQQGTSLAKQVGAVKYLECSALMQDGVAEVFAEAVRAVLYPVTKKNTKKCTLL*
46 >lcl|XP_001367586.1|Plus13516545..3518422 NW_001581876 major facilitator superfamily domain-containing protein 6-like LOC100013183 __SEG__ Chr2 {Monodelphis domestica} MSANPQWDISKALMVARFFHLLCGARDACVTPFLTLYLRQMGLIAPWVGILMGTKHLIATTWAPICSFLAKNYQKRQLLLIGSLLGSAAAGLLLTLISPLDKALVYRFCN
GSSSLMLPINTTLEKELAPNHSAGIKNFTIRVRSPGQELVSGFFISPLGNDQETVLTKEQFTALSALPGAYFEKARITVQATTPLMNKEREMETSPSQTKRSQVNSRVMM
GKGNPQRSMFETTDSSLPLLHVGSELKTPGTLVNLSLAERTRAQDRSLALSLGEHWLFLLSMMAVMFWELLSAPLGPAAADSLYEYLDFVDATDCYRRLWVWKLLGMSIG
VCSVPVLVVQLDCFLAEDTPRAAVHFYGYTAFSILALPVCFAIPIPNFKRREPGHKAIKALSLIGNDCLLFLLAVTVFLTGATVANIENFLFWQMQDQGSSELSMGLSVT
LSLVGEILLHPFKAKILKNLSSLGTLGLGLGCLSGQLLYYSLLWNWWAIFPAQIFGAISNGALWWAVDALVEDLVIPGTERSLSVMLRGLFYGNGASLGSFIGGFVVLHY
SLAVLYKTHCVVLSLWLVLFIAIQSKLPQHRKINYSKLLAVDTADASDSEEGAERDWLIKAMRDEHLTGRAKNKY*
47 >lcl|XP_001367687.2|Plus1complement(12277742..12278536) NW_001582020 carbonic anhydrase 2-like LOC100013286 __SEG__ Chr8 {Monodelphis domestica} MSQRSLTWGYNKDNGPHTWYKHFPIARGKQQSPIDIQIWNAKFDSSLKPLNFNYSASTTRRIVNKGHSFEVEFDSSTDKSVLSGGPLTEKYKLTQLHFHWGRRDEEGSEH
SIDDLKYASELHMVHWNTKYSTVSESIHQPDGLAVVAIFLKVGGAHQELEKITHALGSIRKKNMSTVFTNFNPACLLPDNKDYWTYSGSLTVPPLLECVTWIVLKEPINI
SKEQLSKFRSLYSTMEGEHPKKHIETNCRPRQSLQGRVIRRFLS*
48 >lcl|XP_001367688.1|Plus1complement(4257862..4259070) NW_001587047 vacuole membrane protein 1-like LOC100013287 __SEG__ ChrX {Monodelphis domestica} MANESKWRGESKRIKTVSLVPIAQAIERSRRDREERQKIVLWKKPLTTLRYFLLETVINLKVWAYRVWWWRSILLLTLLLLISAGTVCYIEGPHQLYVSYLEKKILWCSY
WVGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNTVNFPEPPYPERITCPDEAIQEEFISLWAILSKVRLEACMWGAGTAIGELPPYFMARAARLSELEPDDEDYE
EIEEMLEDPDSPQDFASWAKKAIQTLVKKVGFFGILACASIPNPLFDLAGIACGHFLVPFWTFFGATLIGKAIVKMHIQKLLVIMAFSKHIVEQMVTLIGAIPTLGPSLQ
KPFQEYFEAQRLKLHHKSEMKNIMEKENWVSWVFEKLVVVMVAYFVLSIINSMAQSYARRIQQQMNSGEKMN*
49 >lcl|XP_001367704.1|Plus1complement(80676478..80677059) NW_001581968 transforming protein RhoA-like LOC100020086 __SEG__ Chr5 {Monodelphis domestica} MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNV
PIILVGNKKDLRNDEHTRWKLAKMKQEPVKPEEGKDVANRIGAFGYMECSAKTKDGVREVFEMATRAALQARREKKKSRCLVL*
50 >lcl|XP_001367725.1|Plus14247062..4247427 NW_001581994 huntingtin-interacting protein K-like LOC100013325 __SEG__ Chr7 {Monodelphis domestica} MATEGDVELELETESSGPERLPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMLVIGDQRSREQKAKEEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMG
NIVDAHITLTN*
51 >lcl|XP_001368212.1|Plus1complement(17172082..17173194) NW_001581970 THUMP domain-containing protein 1-like LOC100013856 __SEG__ Chr5 {Monodelphis domestica} MAAAAEQPRHMSGVKRRGKAQYVQAKRARRGDGGGGPRQLEPGLQGILITCNMNERKCVEEAYSLLNEYGDDLYGPEKFVDKDKQPSGSEEEEEDDAEAALKKEVSEIQA
STELRLRRFQSVESGANNVVFIRTLGIEPEKLVHHILKDMYTTKKKKTRVILRMLPVSGTCKAFLEDMKKYAETFLEPWFKAPNKGTFQIIYKARNNSHMSREEVIKELA
GIVGCLNPENKVDLSNPQYTIVVEIIKAVCCLSVVKDYMLFRKYNLQEVVKSNREGSQPNPGQDSQVKNGKRAKLELENTDKENLKSNESDSAEDKKNPQVVVEGSKEEG
LQSPLSETQMESEKGAKSENGSQVLEDFKSKESDPDLEKN*
52 >lcl|XP_001368288.1|Plus13603631..3603897 NW_001581928 coiled-coil-helix-coiled-coil-helix domain-containing protein 8-like LOC100013936 __SEG__ Chr4 {Monodelphis domestica} MSSAAPQGHNWTSPQPAAGEEGEDPVEQMISRTGCIAFHHAVMECMAEHHDWRKCQAQVKAFRDCVNQYQKNRLEELRRGQKPVPTDG*
53 >lcl|XP_001368395.1|Plus1complement(8730768..8732372) NW_001581860 ankyrin repeat domain-containing protein 34C-like LOC100014056 __SEG__ Chr1 {Monodelphis domestica} MDETTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGETALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTALIHACIRKAGGEVVSLLLENGAD
PSLEDRSGASALVYAINADDKDTLTHLLKACKAKGKEVIIITTDKSSSGTKTTKQYLNIPPSPKFEDRQSPALCMSPSDIELKTPNLGSPPREKEDDFFSLHSGRSSGCH
SIKVPSEALSPTRKVGNLKRARLPQLKRLQSEPWGLVAPSVLAASSHQEETKSVCADDEIIMGINDLSFPKRAPLSRNNSIEGKDSTLFPTVNDQVLKIPSTSAPASWKA
AYEKNQPIHQRLARRSTLPAEQDNSSITTSGSATIKDSTSLRRLENGHYDSDIQLGGDSSNSMSLDSSKVPLDRKKLNSSHLVLFNGSRESLDGVPSTSPGSVRRRPPNL
LERRGSGTLLLDHISHTRPGFLPPLNVNPNPPIPDIRSSSKPSSPLASGLKPMVPVAPNSPKRVDLRNKKKLIRRYSMQVEQMKQLSDFEEIVT*
54 >lcl|XP_001368765.1|Plus1complement(104268347..104270584) NW_001581902 RNA-binding protein 12B-like LOC100022285 __SEG__ Chr3 {Monodelphis domestica} MAVVIRLQGLPVIAGPVDIRHFFSGLNIPDGGVHIIGGEIGEAFIIFATDEDARRAMSRSGGFIKDSPVELFLSSKTEMQNTIEMKRKRFDRGGRELISGSKRPGSSSSG
TSGVGSLSNLVEAIKKGINKPGYDPSDDPEAGFHTNGTRHGITGPRKETRTFKSDNRYLFLRGLPYSATEDEVRAFFPGLCVDGIILLKHPTGRNNGDCLVKFATSHDAL
GGLQRHRHYMGSRFVEVSPASEQQWIDCGGSADIKDEVHFRSEERSPQRGINDAHSKKRSRSKSPRRMKRRSRSPHKYGFYVHLKNLSLSVEKRDIKNFFRDTDLASDQI
KFLYKDQKRTGSAFVMFKTLRDYNSALALHKFILFHRQVLIDPISKKTMLKFIECYEKKRSGSVGRERPGHIPEKTYREGHSGPKLCIYIRNFPFDVTKVEVQKFFAGFS
IDEDDVYLLYDDKGVGLGEALVKFKSEEQAMKAESLNRRRFLGTEVLLRLISEEQMQEFGVNISSIPSEKMQDHSQTRDRDEHSHSVDPQGPSVHSFGPPGKFRHPPEDF
RQQPDNFRHPPDDFRHPPDRHPPDDFRHPPDRHPPDDFRHPPDRHPPDDFRQPDNFRPPPDDFMCPPDDFRGPRPFMNFGPPEGEPFGRFDFGNNNMGGFPEGRFMPDPN
FNCGSGRVTPIKIMNLPFKANVNEILDFFHGYGVIPESVSIQYNEQGLPLGEAIVAMVNYDEAMAAINDLNDRPVGPRKVKLILL*
55 >lcl|XP_001368991.1|Plus1105939294..105940040 NW_001581902 pleckstrin homology domain-containing family F member 2-like LOC100022729 __SEG__ Chr3 {Monodelphis domestica} MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFA
VYAATATEKSEWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCFDLLSTGDLATCQ
PTRSDSYSQSPKSLNNVSDDEDDEDSSD*
56 >lcl|XP_001369036.1|Plus1complement(3209164..3210219) NW_001581931 membrane progestin receptor alpha-like LOC100014796 __SEG__ Chr4 {Monodelphis domestica} MATAIAQKLSRFFPSVRQLGQMPRILGELAAPLPDSTVGRAEVPRLFWKPYIYSGYRPLHRTWRFYFLSLFQKHNEAVNVWTHLVAAMVLLLRLAYFAGSVDFVGDPHAR
PLFLIVLASITYLFFSAVAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHARMAAFFLPAAAFLAWLSCAGSCYTKYRQLPGMLGRICQEMPSGLAYA
LDISPVVHRIYVAQVLGQEDPAVLYHKCQVAFFLLAAAFFSACSPERWFPGKCHTFGQGHQLFHVFLVLCTLAQLEAVALDYEARRSIYEGLHRHALHNFSALFLLTVVC
SVLTALFLSHRVRQELRCKED*
57 >lcl|XP_001369054.1|Plus1complement(84588545..84590854) NW_001581961 myotubularin-related protein 10-like LOC100020247 __SEG__ Chr4 {Monodelphis domestica} MFSLKPPRPTFKSYLLPPAPPPQDEDRSIPEPKIKKLDPVLLPGEIVVNEVNFVRKCIATDTSQYDLWGKLICSNFKISFITDDPMPFQKFHYTNLLLGEHDVPLTCIEQ
IVTVNDNKRKQKILGPNQKLKFNPTELIIYCKDFRIVRFRFDEAGPESAKKVCLAIAHYSQPTDLQLLFAFEYVGEKYHNTAKNINGIDSGSGGIPGGNSQKTPLFETFS
DWDREIKRTGASEWRVCSINEGYMISTCLPEYFVVPSSLADQDLKLYSHSVFGRRMPLWCWNHSNGSALIRMALIKDVLQQKKIDQRICTAITKSHPQRSDVYKSDLDKN
LPSIQEIQAAFVKLKQLCVDEPYEETEVKWLSSLENTRWLEYVRAFLKYSAELVYVLESKHLSVILREEEGRDLSCFVASLIQVMLDPHFRTITGFQSLIQKEWVMAGYR
FLDRCNHLNRSAKESPLFLLFLDSIWQLLEQYPAAFEFSETYLMLLYDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWDWSLQFAAKDRTLFNNP
LYIGKSAPCVQNGSVKSFKRTKKNYSSTLRGMPPSFKNGLINDQDLLPRRNSLILKLKTDIEQTDSQSTDMEQYFRDWFSKPVDLHGVILPRISGIHIKLWKLCYFRWVP
EAQINNGGFITAFHRISLLTDEIDMLSRSLRQYKSNSSQSSYSELDQSRMYFKANGINDTSGTPEFLSSSFPFSPIGNLCRRSILGTPLSKFLNGAKIWLSTETLANED*
58 >lcl|XP_001369200.1|Plus1complement(10157518..10158681) NW_001581860 UPF0580 protein C15orf58 homolog LOC100015004 __SEG__ Chr1 {Monodelphis domestica} MAVPQNINETSHLPPLSNGCDEQSRLSVGLGVLDFVYRQEELRVKGIQWQTSESGELCPPLLSRFDCALQSSWKQRMEQGLFRYCLGDLQTQILPGPLGFVAQLNVERGV
QRRPPQNIQSVRQAFDPQQFHFNKIQPGEILFHLCRDPGFPMALQCTEVLVIINVSPLEWGHVLFVPEPTQGLPQILMPGPLQFGIEAVMLSTHPGFRVGFNSLGGLASV
NHLHLHGYYLAHKLPVEIAPSQPLDPSGHIHLLEGLPAPGFLFYIDEPGPKLEALVGRVCQVTNYLADQEIAHNLFVTRGAPPGNPPSSLTYSGIRVILWARKSRFGVKE
GEAFNVALCELAGHLPVKTSQDFHSLTETSAVNLIQQSLLPPSQFLQLQEALVSLLK*
59 >lcl|XP_001369529.1|Plus168096012..68098153 NW_001581835 zinc finger and BTB domain-containing protein 1 ZBTB1 __SEG__ Chr1 {Monodelphis domestica} MARPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHTTAQLNLSNMKISAECFDLILQFMYLGKIMTAPANFEQFKVAMNYLQLYNVP
DCLEDIQDADCSSSKCSSSASSNHNNKMIFGVRMYDDTIARNGSDANRWCVEPSSTVNTSQNKEPDEESLQLGSFPEQLFDVCKKSSVSKLSNPKDRVSRRFGRSFTCDS
CGFGFSCEKLLDEHVLTCTNRHSYQNTRAYHRIIDVRDGKDNNTKTDSCEKDSSKPFSAQIDKYRGDTTQTTSDSSSATGNRKSSTIESEIAGEEKSRAAERKRIIIKME
PEDHPKDEFKDFNVIKVSDKDCNESTDNDELEDEPEEPFYRYYIEEEVNMKKNARKLLKPRMSVNTDERNSLENARHPNKDSPVQGDTEGASCELCGQTITEEDLSSHYL
SKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTVNGLGNSEEKMDMEENPDEQSEIRDMFVEMLDDFRDNHFQINSLPQKQLYKHSACPFRCPNCGQRFENENLVV
EHMSSCLDQDMFKNAIIEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSSG
ETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT*
60 >lcl|XP_001370181.2|Plus1complement(5605028..5605831) NW_001581876 BTB/POZ domain-containing protein KCTD11-like LOC100016304 __SEG__ Chr2 {Monodelphis domestica} MPSQAPSFGGPVTLNVGGTLYATTLETLTRFPDSMLGAMFREGAALPPNSGPQGSSYYFIDRDGKAFRHILNFLRLGCLDLPRGYGETALLRAEADFYQIQPLLDALREL
EVTQGTEVVTAALFHADVDATPRLVHFSARRGPHHYELSAARVDTFRANIFCTDPTCLGVLRARFGVAEGEGGDGSPHFRLEWAPCPEGLPEVEYRRLGLKQLWAVGEAG
ERREVLGTPGFLEEVLQVALEHGFRLDSVFPDPEDLLNSRSLRFVRH*
61 >lcl|XP_001370507.1|Plus161075792..61076733 NW_001581861 small glutamine-rich tetratricopeptide repeat-containing protein alpha-like LOC100026793 __SEG__ Chr1 {Monodelphis domestica} MEDRKRLAYSIIQFLHDQVKHGRLSSDAQESLEASIQCLETAFEVTVDDRHLAVSQTLPEIFEAAIERGEVRNIHKNSEPIPTIDKETPEAERFKRKGNEQMKKENFEEA
VSFYGKAIELNPTNAVYFCNRAAAYSKIGDYAGAMKDCERAIGIDPYYSKAYGRMGLALLSLNKHKEAVGYYKKALELDPDNDMYKTNFKLAQKKMKETSDATENTGGID
LAGLLSNPGLRNMASNLMNNPQVQQVVSGVASSIQNHSGAARGNRSPNNISNLLQAGQHFAQQLQQQNPELIEQLKNQIRSRSSKTSNDDQKE*
62 >lcl|XP_001370820.2|Plus1complement(30354311..30357559) NW_001581970 zinc finger protein 518B-like LOC100017182 __SEG__ Chr5 {Monodelphis domestica} MQIKKMKEIIPQLYTDQVNDKNNSLTTSPKQLANEHVSQPNGHESQSHGYQDSKAEDDKMCMVTCLRCRSLQKVPLQELKKDNQYSQIEDQMFFVCVKCTFGVSPPIPFM
NDMPGSIDSGNKDATISRTITNQFKVKNFQPGKYYCDKCRFSTKDPLQYKKHTLQHEEIKFFCSHCSYVSYTKGEFQRHLVKHTGTFPYQCEYCDYGAVRNDYIVKHTRR
VHETSGEKRPLRQVMEHQPKRTNFSKQNSEVLVNEVSKSNSFLNEPTDSPLYFPSHGDQDKTGPAISLPETKECSRDEAASAPDKACLPEPSKVNLFENENVEVELLSPA
KEPVQPGMPLTVVAPAELRVPENCLAQLIDVKVVNGTQQLVLKLIPMKEKNGFKLGSSDEGKYEPMNKYTVPNEQEKLVPTEPTPPAMEGSPEKPLGINNLHSTDYTHAK
DLDCIKSSDSQVLKNMSITNQCESCPNNDRVGNWRQEVLSFPYRTALSPVSSRDGHIEQNNFSSLSVMNNGTLCSPVKRLSVLPTVAALSPCQERSQNHLEKPSSNSKPT
EALVALAKRDTLPVNQEASLNKKEVDTFKMVAFSEKLNQAQAKEPSGDPNSMQDSTLCRSEQSHINLIRENDIKTQDPEEVMSEDLVGVALQNSGSNITSSDGPVISSVF
SLSSGVENIPEGIKWDNACFRTKSFNSLQKKIAQLIAATESSKTSLSPSSTVEQQSLPLETPLDCIQGHNAPSIDRVPPQALQNNATGIELLINEQMQHHNNVDEQTKAR
EVTDNHDAVSVFIPKDTGLKAFSSTENEHLVENKLPNGGNKRELSKSVSFNFLEQIGEDLSLTNESQLIDSSRNFGTSLGNKPNQEYTTSTVSKKSDSSCPQTKEDNNQD
KQEKLTFSGPSGSKINTKQALISKKKNKIISDSSHMLPDVCIFMTARHLRLIPLKTEQLIKCPRRNQPVVVLNHPDVDSVEVINVMKVVHKYKGNVLKVVLSERTCDQLG
IKRHHRRLIYQNLEAVCPVKKTMLKMKLKKIHKNSYQVVDSLPDESVQGMFKCWFCGRIYEDQEEWMSHGQRHLIEATRDWEQLSPPLGTPK*
63 >lcl|XP_001370911.1|Plus114177296..14179068 NW_001581976 calicin-like LOC100017313 __SEG__ Chr6 {Monodelphis domestica} MKLEFTEKNYNNFVLQNLNKQRKRKEYWDMAVNVDDHVFFAHRNVLAAVSPLVKSLISNNDMKNTDELFITIDSNYLSPSSVEQLMDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCTDFLLKSIKRNNSLRYLFLAELFELKEVSDCAYAGIRDNFYYWVSHEGSSHFMQCPPVIFGRLLRDENLHVQNEDQALTALLHWVLFKKEDREKYFKKFF
SYINLNGVSNKTLIFASNKVGGMENSNALTLIENVLLDRKQEKPSRLLNFQRKGALLDAVVILGGQKAQGKFNDAVFAYIIEEDIWLKLTEMPYKAAALSATSMGKYIYI
SGGTTEQISGLKTSWRYDMDENSWTKLPDLPMGLVFHTMVTCGGVVYSVGGSVAPRRYISNIYKYDERKELWSLVGKMSIPMDGTAVITKGNRHMYIVTGRCLVKGFISR
VGVVDCFDTCTGEVVQCITFPIEFNHRPLLSFQQDNILKVHSHRQSVEINLQKIKASKTASCVPLLPNNCALDVSHAVCPIGDNKVFVCGGVMSGNDTHNKDYTINKNAY
LLDQKTGEWKIITPPPEALDCPACCMVKLPCKVLRRIDNI*
64 >lcl|XP_001370987.1|Plus1complement(17593622..17595325) NW_001581994 guanine nucleotide-binding protein-like 3-like protein-like LOC100017424 __SEG__ Chr7 {Monodelphis domestica} MTKRRGRTASRGPGSKPRRSGSKPRLLAPTPRPGLSGSGAAGAAAARPGREAELRKQRQDEMREKQRAAREREKGLRRSLEGLQREVLQRQREHEQRERDLQALERQQHP
QLEREASRKAYYREFRKVVDAADVVLEVLDARDPQSCRCPQVEQAVLQAGGSKKLVLVLNKIDLVPKELVEKWLAYLRNEFPTVAFKASTQQQNRNLQQSKVPARQASAE
LLSTGACIGADCLMKVLGNYCRSQDLRTAIRVGVVGFPNVGKSSLINSLKRARACNVGATPGVTKCLQEVHLDKYVTLLDSPGIVLSPSTSDTALILRNCLKIEQLADPV
TPVEAILRRCSHEQLSQHYGLPHFNNTMEFLVLLARRLGRLKKGGTPDQEKAAKAVLTDWMNGKIGYFTHPPETHKLPTHISAEIVSEMGKAFDFEALEQGNMEALASMS
TGPISFGQKPFNLTSETEIEMPEEEEEEFWDAREDLEDFMDEDKDPEFGAITVELKGSKIKKPEEAKQKLPQAPKLEEIWAMDPLHQGQGLAAACKRRKKLQKRANKLAT
KLSDSLVAALDLTITDE*
65 >lcl|XP_001371476.1|Plus1complement(2745778..2746605) NW_001587048 progestin and adipoQ receptor family member 4-like LOC100018138 __SEG__ ChrX {Monodelphis domestica} MARRSGPRLLDWINTPSHLQFNPFILTGYRPASSVSGCVRSLFYLHNELGNIYIHVLALLTFLVMLPLTIPWDQLGWGHWLGCTHFLACLAPPAGSILYHLFMCHRGGNR
VYSHLLALDMCGVWLANSLGAIPMIQCTLLCWPCLRLFALVMYAFLSVMAGWWALTALSTTARLQAFGWQAIARLLVFGIRWLGLGTGAPRSLLCYLRMDALALLGGLVN
VARLPERWGPGIFDYWCNSHQIMHFLSVISILQMHAGVIPDLVWAASHDYACPDD*
66 >lcl|XP_001372144.2|Plus1complement(16782110..16783033) NW_001581976 mitochondrial carrier triple repeat protein 1-like LOC100019221 __SEG__ Chr6 {Monodelphis domestica} MKKKDLLHCVMDSEAHEKRRKNLSPSSNQDTSHNVNVNEFKHYLCGCCAAFNNIAVTFPIQKVLFRQQLYGLRTRDAILQLKKDGLRNLYRGILPPLMQKTTTLALMFGL
YEDFSCILSRHVISSPEIVTRSVAAVLAGTTEALLTPLERVQTLLQDQKNNDKFTNTLHAFKALKSYGIAEYYRGLIPILFRNGLSNVLFFGLRGPIKEYLPEAKSHSAH
LVDDFICGGVLGAMLGFIFFPLNVVKTRMQSQIGGEFQSFSQVFGKIWVERNGKLTHLFRGAHLNYHRSLLSWGIINATYEFLLRLL*
67 >lcl|XP_001372243.1|Plus1complement(30745164..30746411) NW_001581900 RNA-binding protein 41-like LOC100019367 __SEG__ Chr3 {Monodelphis domestica} MKRINSSLSSDDLILEDLETEGERQLRSLLHHQLDTSVSVEECVSKKQCFAPAAVYKPFGEEAAGVLSLSQFQALQKSDQEIASLRDLGLTDREIMLWKNRASLERGTGL
GATPEATQDCLRDIEEKISEHQRILALPQRFAGCKQLSRREMEIEKALFQGNDRHSFLRALYYQGESHKRLEAEKDPINNLETVYQEMMAKPHLKEAQLMRDEPFACPLL
DSHALADSSVTAKNLSVLEAQGNQAAQAKGPSLCVVKVIESEAQQYLTEPKKLTEVVEFVPEDEIERNRLSQEDIRKIPMFASYSPGEPNKVLYLKNLSPRVTEKELVSL
FARFQEDKGTPIQFRVLTGRMKGQAFITFPSTEMAQQALLLVNGYNLLGKTLVIEFGKHKKQRAGLHLAPPTPHVTHNMTEQDEN*
68 >lcl|XP_001372276.1|Plus122150365..22151495 NW_001581995 progestin and adipoQ receptor family member 9-like LOC100019416 __SEG__ Chr7 {Monodelphis domestica} MPLRLQPRGAGTKNPSAASSSSSAPALTAASPSPTLPGPKPLLRWDEVPDDFVECFILSGYRRLPCTAQECVASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGRDD
LPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRATFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDASVMTPYVQQRLGWHVDCTRLIAAYRALVLPVAFVLA
VACTVACCKSRSDWCTYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQMHYVEE
GLRQFLEAPPASPTFSGTVGYMILLVLCLGLVIRKFLNVADLCKED*
69 >lcl|XP_001372447.1|Plus1complement(20944586..20945713) NW_001581868 histidine protein methyltransferase 1 homolog LOC100019674 __SEG__ Chr2 {Monodelphis domestica} MTFQFNFTIDSHQENELTSLGDETSGLESSAKTSLLGSQKGNLKGGKWSSEECYLSEEPLWGCKSSPKLQVFQDYDNSLANSDEITRDLGPKEKESYLKVAKEHDVPKDL
KKVVEDKVVEVIPDLQHMNLSIVKMAFLKDNSCGEDIVSKSFSSHSDLITGIYEGGLKVWECTFDLLAYLWDEKIQFAGKRVLDLGCGAGLLGIIALKGKAKEIHFQDYN
STVIDEVTIPNVIVNSTFECEDDEVNEPDLKRRKILNPTQELCIKCRFFSGEWYEFSKLVLSSKKAFAKYDIILTSETIYNPSYYSSFHQTLASLLDENGQVFLASKAHY
FGVGGGIHLFQKYVEERNVFETSILRIIDEGLKRVLIKMAFKQTH*
70 >lcl|XP_001372743.1|Plus1complement(103184156..103185916) NW_001581841 ezrin-like LOC100029635 __SEG__ Chr1 {Monodelphis domestica} MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLKLDKKVSAQEVRKESPLQFKFRAKFYPEDVPEELIQDITQKLFFLQVKDGI
LSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLGSERLIPQRVMDQHKLSREQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGV
DALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRR
ETVEREKEQMLREKEELMMRLQDYEQKTKKAEKELSDQIQRAIQLEEERKRAQEEAERLEADRVAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKED
EVEEWQIRAREAQDDLVKTKEELHQVMTAPPPPPPPVYEPVNYHVHENLQDEGTEYSGYSAEFSSEGIMDDRNEEKRITEAEKNERVQRQLQTLTNELSQARDENKRTHN
DIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM*
71 >lcl|XP_001372768.1|Plus138737503..38738831 NW_001581902 tRNA wybutosine-synthesizing protein 2 homolog LOC100020165 __SEG__ Chr3 {Monodelphis domestica} MEAQDGKSEVMLAVVTEPQFTQHYREYLEKQQLLDRRHRVKQLPDGTIALPVVGETLSEQHLLALRQQGTPENICRLVHIPKPILSKKAQRCSPAQKLCQELQCLVESQG
HMWSTELEKDLPRSWQRHGDLLLLSEDSFKDPHWKKLEPGLWKTVASALGGQRLAKRGRVSPGGTRTPKVILMLGDHGWVEHVDNGIRYTFDVTQSMFSFGNITEKLRVA
SMSCAGEVLVDLYAGIGYFTLPFLIHANAAFVHACEWDPHAAAALKKNLELNGVSDRCSIHLGDNRKLKLRSIANRVNLGLIPTSEEGWPIACQVLRQDTGGILHIHHNV
ESFPGKDLQLPSSSEAGQKEQIAARNSGRQTPAKVPKLEWRKWAEVVAARIRDLLLQLHGNPWETHILHIQPVKSYAPHVDHIVLDLDCRPLSYSGKGVEKAEKTCNQRP
KV*
72 >lcl|XP_001372915.2|Plus1complement(5659181..5659732) NW_001581997 ras-related protein Rap-2a-like LOC100020398 __SEG__ Chr7 {Monodelphis domestica} MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVP
MILVGNKVDLEGEREVSFGEGKALAEEWSCPFLETSAKNKASVDELFAEIVRQMNYAAQPNGDDQCCSSCVIL*
73 >lcl|XP_001372987.1|Plus1complement(111766376..111768244) NW_001581841 RNA-binding protein EWS-like isoform 1 LOC100030020 __SEG__ Chr1 {Monodelphis domestica} MASTDYSTYSQAAAQQDYSAYAAQPAQGYAQTTQACGQQSYGDYEQPTDVSYTQAQTTAMYGQTAYATSYGQPPTGYTTPTSPQAYSQPVQEYGPGAYDTTTATVTTTQA
SYAAQSAYGTQPAYPTYGQQPARPQDGSKPAETSQPQSSTAGYSQPSLGYGQSNYSYPQGPGSDPRQPVTAPPSYPPTSYSSTQPTSYDESSYSQQNTYGQQSIYGQQSG
YGQQPPTSGPPQTGSYSQAPSQSSQQSSSYGQQSAFQQDHPSSMGVYGQESGGFSGSGENQSMSGPDDPGRGRGGFDCGGMSRGGRGGGGGGHGGMGSAGERGGFSKPGG
PMEEAPDLDLGPPVDPDEDPENSAIYVQGLNESVTADELADFFKQCGVVKMNKRTGQPVINIYLDKETGKPKGDATVSYDDPPTAKAAVEWFDGKDFQGSKLKVSLARGG
MPPREGRGMPPPLRGGPEGPGGPGGPMGRMGGRGGDREGFPPRGPRGSRGNPSGGENVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGRGGPGGMRSGRGGLMDH
GGPGGMFRGGRGGDRGDFRGGRGMDQGDFGGGRRRGPGGPPRPLMEQMGGRRGGHGRPGKGERRQERRDRPY*
74 >lcl|XP_001373229.1|Plus1complement(1312902..1313441) NW_001581914 AN1-type zinc finger protein 2A-like LOC100020900 __SEG__ Chr3 {Monodelphis domestica} MEFPDLEKHCSEESCGQLDYFPLECDGCNKAFCKDHHKSSRHKCSDAYKKDVQVPVCPLCWAPVPVGRGKIADIVVGKHMDGDCKYNPAKEKPKIFIHRCSKEGCEKKEM
FKLVCEQCQDNFCIKHRHPLAHNCKHRDHPISKAGCAAIMRASESKSSGASNKLSSSWLAQQLRGKQKC*
75 >lcl|XP_001373544.2|Plus1complement(36653070..36653645) NW_001581969 rho-related GTP-binding protein RhoH RHOH __SEG__ Chr5 {Monodelphis domestica} MLNSIKCVLVGDAAVGKTALLVRFTSETFPDMYKPTVYENAGVDVFMDGIQISLGLWDTAGNDAFKSIRPLSYQQADVVLMCYSVANHNSFLSLRNKWIAEIRSNLPCTP
VLVVATQTDQREMGPHRASCINAVDGKRLAQEVKAKGYLECSALCNRGVQQVFECAVRTAVNHARKRSRRKLFSINDCKIF*
76 >lcl|XP_001373760.2|Plus141313915..41314973 NW_001581879 zinc finger and BTB domain-containing protein 44-like LOC100021683 __SEG__ Chr2 {Monodelphis domestica} MGVKTFTHSSPSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLTACSDFFRTKLVGQAEDDSKNVLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASY
MQMFSVASTCSEFMKSSILWNTPNNQQEKGLDAGQENSSNCNFTSRDGSLSPVSSECSVVERTIPVCRESRRKRKSYIVMSPESPLKCSTQTSSPQVLNSSASYSEPRNQ
PVDSSLSFPWTFPFGIDRRLQSEKVKQVENPRTLELPGPSEAARRMTDYMTCESTKANLPLVTEKDVRVKVERLSDEEVHEEVSQPVSASQSSLSDQQTVPGSEQIQEDL
LISPQSSSKGIMSFVFLHIIIL*
77 >lcl|XP_001373813.1|Plus118447252..18447863 NW_001582017 PQ-loop repeat-containing protein 3-like LOC100021755 __SEG__ Chr8 {Monodelphis domestica} MEAGPLLHFCNWSTLVVCMVIKFPQIFALLSAKSSRGVSLKSLLLELAGFLVFLRYQSYYSYPLLTYLEYPILIAQDVILLLCVFHYNGNIKQAIPYIAVFLGGWYLLTL
QKWIIDLAMNLCTFISAASKFAQLQYLWEAKDSGAVSALTWSMSAYTCATRVITTLMTTQDLMVLVRFLIMLALNIWVTATILRYRKTTTKDE*
78 >lcl|XP_001373910.2|Plus128015926..28016729 NW_001581995 BTB/POZ domain-containing protein KCTD11-like LOC100021892 __SEG__ Chr7 {Monodelphis domestica} MPSQAPSFGGPVTLNVGGTLYATTLETLTRFPDSMLGAMFREGAALPPNSGPQGSSYYFIDRDGKAFRHILNFLRLGCLDLPRGYGETALLRAEADFYQIQPLLDALREL
EVTQGTEVVTAALFHADVDATPRLVHFSARRGPHHYELSAARVDTFRANIFCTDPTCLGVLRARFGVAEGEGGEGSPHFRLEWAPCPEGLPEVEYRRLGLKQLWAVGEAG
ERREVLGTPGFLEEVLQVALEHGFRLDSVFPDPEDLLNSRSLRFVRH*
79 >lcl|XP_001374166.2|Plus1complement(10408088..10408831) NW_001581850 probable N-acetyltransferase CML2-like LOC100022265 __SEG__ Chr1 {Monodelphis domestica} MGIWGNRFTWISSTGPQGLEAAAFMAPYEIRRYQDQDWCSVRAIFAEGMLQQVVPNFWNLLRQPISFLLLLGGPGALLLASGSLLLSLLAVPGFLAVLWLVARYPFSYYV
HDTLHRDMWDIRASYLNDRGSCFWVAEAGGQVVGLVCACPAQKASGAQKHLELLHLSVRQDHRGQGIAKTLTQTVIHFAQDQGYSGIVLVTASLNFPARRLYERLGFWKS
HETLKSVKWSIISISLTHYKYALSPSP*
80 >lcl|XP_001374195.1|Plus1complement(10436135..10436803) NW_001581850 probable N-acetyltransferase 8B-like LOC100022311 __SEG__ Chr1 {Monodelphis domestica} MAPYHIRKYQDQDRETVIDIFTKGILYHVPASFFHLLKQPRSFLLLFGVSGAMFLGSGSCILSLLAFLGLLIILWWIVRYPYSDYVDHALHTDMRDIRKSYLSDKGSCFW
VAELEGRVVGIVCARPVEEALGQKQLELLHLSVGQEHRGQGIAKSLTQTVLQFAQDQKYDNVVLNALNFNYAAQRVYESVGFWKTHEAYDSLKWKMIAIPFFFYEYTVPS
SL*
81 >lcl|XP_001374291.2|Plus1643224..644534 NW_001581942 G patch domain and KOW motifs-containing protein-like LOC100022443 __SEG__ Chr4 {Monodelphis domestica} MANGQDGATATPAQVSGPPGLVSFGFSRTAPRKRLAEGHEGPPGQRGEEEEEEKDFLRAVEGRELRSVRPPAEAPRELVIPLLPRGRGRGAAPEDAVLCQAVQELIEESQ
RALQQPSDGAEAADPSLAIPLLARAGAETEAAAAPSVGADYEAVPVEAYGLAMLRGMGWKPGEGIGRTFKQVVKPRENPLRPKGLGLGASLAPSPAPAPPGNKRASEEPE
GLAPGKAVLVLAGPHRGLYGKVEGLDPDNARAVVRLAASGQAATLSEYVLRPVSCQEYEKQAKGPGRPPGDPQAGGAGQGAKKKGQKRKQPPTTPHWLRRDLRVRFVDKR
HHKGRYYNTKMIIEDVLSPDTCVCRTDEGRLLEGLREDMLETLIPKEEKATVMVVLGPQRGQVGRILARDKERSQALVQLLQEGEGTVLRLDFDAVCQYVGPVAED*
82 >lcl|XP_001374344.2|Plus115770162..15770734 NW_001581965 transforming protein p29-like LOC100022523 __SEG__ Chr5 {Monodelphis domestica} MLYKLVVMGSCKVGKSALTIQLVKNCFVPDYDPTIEDSYHTQLVVDGEPCQLDIVDTTGSEEYQSHRQEFMRRGQGFLCVYAVDDIKSFVDVNIFLDQLRRIRDTDRVPL
VLVANKTDKADCLVTRELGQEAARSFRVPFVETSAKTRPSVERAFGELVREIRRFSVQELRHRRDAEHDRGCGFTPCHIM*
83 >lcl|XP_001374346.1|Plus134324954..34325235 NW_001581981 HIG1 domain family member 1A-like LOC100022525 __SEG__ Chr6 {Monodelphis domestica} MSSNSDVSLSTYDESLGSKLALKVKGPPFVPIGIAAFAAIVASGLYKLKSRGNNKMSVHLIDMHVGAQGFVVGAMTVGMLYSMFWEYWAKPNP*
84 >lcl|XP_001374435.2|Plus11246584..1247504 NW_001587056 mitochondrial carrier triple repeat protein 6-like LOC100022651 __SEG__ ChrX {Monodelphis domestica} MREQPEAPLEKPEEGKRAKIPEDHHWHSRSYTLGAISSFLSTFVTFPIYKVVFRQQIHAVSVPEAVSQLHQEGLHRFYRGIYPPLLAKTLQGTLLFGTYDNLLQALSPTG
PSRLWQRWVAGFLSGAMEAVVLTPFERVQNVLQDGRKDARFPSTSSILREFNSYGFWERLALGYYQGFLLVLLRNSLGSALYFSFKDPIRDSLAEQGLPCWVPALVSGSV
NGTLTCLLLYPLSVLVANMQSQVGCQEAPGLWASAQAVWEGRGRKLLLIYRGGSLVILRSCVTWGLTTAIHDFLQENKCPRVEESD*
85 >lcl|XP_001374469.2|Plus11315390..1315995 NW_001587056 ras-related protein Rab-9B-like LOC100022701 __SEG__ ChrX {Monodelphis domestica} MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLSNWQKEFIYYAD
VKDPDHFPFVVLGNKVDKVERQVTTEEAQAWCVEHGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCLLGHTVDLNSSSKAGSSCC*
86 >lcl|XP_001374476.1|Plus1complement(1884267..1885868) NW_001581929 ubiquilin-1-like LOC100022717 __SEG__ Chr4 {Monodelphis domestica} MAGAREEAGDSRLVAGREPQPPRIITVTTKTPQERQEFTLAENCSVREFKEQISKRLNYDVNRLVLIFTGKILRDQDTLNQRGVLDGTTVHLVVRYRFPGFTRSCHTPAT
PASPPMSGTHATSNQPLPGSNIPGSSPSSVASGLLARLGRIARGSPDLADFLGHLTQLLMAVPEAVVQFLDDPSIQGLLGENPSSTNPSPGTGPGRLIGQPQHAPPAHTA
ETVPEALRSPALLRELLMLRADERGLGALKAVPGGDNALRQVYADIQQLMLTVPASSPRAKGPASLSGPSNSSPAAGTLRLGNMWPGTQGRVLGTPSRGNSYSTSMPNLF
MGLGPGSHDVSPTVGKDSLPGPSIPSTSALRNALHALHQNPALLHQLTTGSPLRPRLPLLPILTNPRALQAWLQIEQGLQTLSMEVPGLGPCLRGSGRPSGGHGVGIAGG
SNARVSTQQPTLAVLQLLQSLAHASPTTLQTSPPPPPPQRSPPPAEGRYQQELDQLKAMGFTNRDANLQALIATGGDIHAAIERLLGPGIPQA*
87 >lcl|XP_001374726.2|Plus1complement(5781703..5782890) NW_001581841 torsin family protein C9orf167 homolog LOC100023073 __SEG__ Chr1 {Monodelphis domestica} MRRKFRILRKSRMRANLPGEASLALSPSPSRLLQRQISLDRAKLCNTPVSLLHHRAHFEKPQYFTFEAPVESSSRRRKKPRRTRVVLYPESSRKYLPIEQKSKAKRCLLL
LVAIVCFQILNAIENLDDNLQKYDLDGLEKALQRGVFGQKAATDSIMELLRDYLATHIHSQPLVISLNGPSGVGKSHVGRLLAKHFRSVMEGDFVFQYYVMHHCPDCQEG
FTCRQDLSERITDMVTRAEVEEKIPVFILDEVEFMSPGLLDTLHGFLQPRQSNEFLNAIYVLISSIGGSEITRFVLQNVSSELNPRCRSEELGHTVHTLLVGSHPLWETA
QVVPFVLLEKWDIMNCFLDEMVGEGFYPNQSHIESLAGQLSYYHTKGGEFAVTGCKQVVAKVNLL*
88 >lcl|XP_001375111.1|Plus1complement(21202011..21203201) NW_001582017 mTERF domain-containing protein 3, mitochondrial-like LOC100023620 __SEG__ Chr8 {Monodelphis domestica} MVRGIGRGITSMFRILLMRSQPCTLCPSKKIEASKYEPFLRHFTNTMDGQKPNGENSMTVENLCSLSVDIRKIRRVKGWVLCKKETYVKEIANILQKIGTNETAIADILE
RCPEAILCSPTEVNAQIDLWQSVCRNKKELVALIEQFPESFFTIKDQENRRLNIKFFQELGLKNVIISRFLTTAPIIFCNSIENNKQIIKMLQESYLNLGGSQANMKVWL
LKLLSQDPFILLISPTPIKKTLEFLQNHGFTDFEVLHLLSKLKGFLFRLSPTSVQESILFSKNAFQCTDQDLKELILKCPALLYYTAPVLEERIQGLLKEGISLSQIRET
PMVLELTPQIVQYRIQKLNALGYSIKNGNLDNLNGTKKEFESNFGKIQAKKERPLFNPVAPFKVEE*
89 >lcl|XP_001375405.1|Plus123946413..23947798 NW_001581861 kelch repeat and BTB domain-containing protein 13 KBTBD13 __SEG__ Chr1 {Monodelphis domestica} MAAPTPQPSLPGCIRVWVGGRLFVADKALLVENSDFFRGLFRSGMQEASRGEIHLGVLSAGGFQTTLEVLGGQRPALGGEEELFEAVECAAFLQAPPLAHYLSHSVTSDN
CVVLCEAASAFGLWEVLQGAALFIRDGPPELTNELSPEVRSYVEALRPSSFVAVGTHTPTPQYLEDATRTLCYLDEKDDVWRTLSSLPVEASTLLAGVTTLENKLYIVGG
VRGANKEVVEPGFCYDADRGTWHEFPSPHQARYDVALVGYEGSLYAIGGEFQRVPLRSVERYDFASGCWTFIADIPQPAAGVPCAQALGRLFICLWQPADTTAVYEYKPG
ADSWLPVASLRRPQSYGHCMVAHRDSLYVVRNGPSDDFLHCAIDCLNLATGQWTALPGQFVNSKGALFTAVVRGDTVYTVNRMTTVLYSVGDGSWRLLREKAGFPRPGSL
QTFLLRLPDVALAPAVSSPEP*
90 >lcl|XP_001375749.1|Plus1complement(8408510..8409943) NW_001581841 abhydrolase domain-containing protein 16B-like LOC100024503 __SEG__ Chr1 {Monodelphis domestica} MCVNCFAKAIGQMYKSLTANSYDDFKTWPVDFRWDEVKSQSRSLPALGGAGAATGILRKLSITSTSTDSQDDPDSNFLDHIRDLPRQLASYVLAHSLGRWLVYPGSLVIA
TKALLPGLLRGQALLQDRYKGQRAKLLACDGNEIDTMLVDRRKCPGPQNRGLRLVICCEGNAGFYETGCLSAPLEAGYSVLGWNHPGFAGSSGVPSPQNDANAMDVVVKY
ALYRLRFSPEQIVIYGWSLGTFTATWATMTYPQLGALILDAPFDDLMPLALALKLVPAFCKGLVERTVREYFHLNVADQLFCYPGPVLLIRRTMDEVVNSEALPKEEENK
GQDLRPADLEGNRGNYLLLKLLEHRYPKLMTDESMEAVRQWLHASNSAQEAAINQQYCVDARWCLTVLHNYRINSIKYRKKIKWKDQTTTHASNLHGPDFPWDVGADLSP
GQQKRLAIFLAQKYLKNVEAPHSGPLSAEAFQLPWTL*
91 >lcl|XP_001376006.2|Plus114890376..14892409 NW_001581875 signal peptide peptidase-like 2C-like LOC100024901 __SEG__ Chr2 {Monodelphis domestica} MATMDLLLPLVLLLLVATPAHGEYGVVHVVSGKGSKDYCALFSSEYVTLPRDLHHAPLLPLHDGTKAPWCPSENTYQSSPQGTNPQKPLSKTTAMVLRGNCSFYAKGRLA
QGQGAYGLLIVSRAGDLQCSDTTPLPVTYQSQGLLPDLTIPVAVLRYDDMLDILNQARGRAIPRVAMYVPLEPVLDYNMVIIFILAVGTVAVGGYWAGMSEAERLQRRRE
RRGGAANISEEAEGVAEEEEEEEEPVDFTPAMTGAVVLMSCSIMLLLYFFYDCFVYIMIGVFGLGAGTGLYSCLSPLARRLPLGHYQLILPGLQTYLQLSLILLAGLCTS
ITAIWMIFRNEERWAWFLQDTLGVAYCLFVLRRVRLPTLRSCASFLLALLAFDVFFVFITPFLTRTGESIMVEVASGPSDSTSHEKLPMVLKVPRLSFSPLTLCDRPFSI
LGFGDIVVPGFLVAYCHRFDIQVRSSRVYYMTCTLAYAVGLLVTFLAMILMQMGQPALLYLVSCTLITSLGVAVCRQELSLFWTGQGFVKPPTHPVIQSPPSPDNRMMAE
EPSPSPEQKSEEHTDIQPIVKTKELNEEGASLLESSLTGDSEETLLPAEDGGTSPCCLTDSSEGWSDANLDPEELPTPPLGTNENPGTPGTQVGELNDAPEDTVAWTGLH
KRKGLKVKKSLSAQASL*
92 >lcl|XP_001376091.1|Plus1270787..271596 NW_001582012 uracil phosphoribosyltransferase homolog LOC100025019 __SEG__ Chr8 {Monodelphis domestica} MPCHNQQLGPPAAATSPCPEPVAPGDGPGQEPAGGRGKLPAANGADNAGGPLAEDCESQGLFCHQLGPQLKVLPMNDQIRELQTIIRAKTASRGDFVFSADRLIRLVVEE
GLNQLPYERCTVTTPTGHKYEGISFEKGNCGVSIMRSGEAMEHGLRDCCRSIRIGKILIQSDEDTQRAKVYYAKFPPDIERRKVLLMYPILSTGNTVIEAVKVLIEHGVQ
PSVIIVLSLFSTPHGATSIIREFPDLRILTTEVHPVAPTHFGQKYFGTD*
93 >lcl|XP_001376093.1|Plus1complement(1118417..1119271) NW_001587032 n-lysine methyltransferase SETD8-like LOC100025021 __SEG__ ChrX {Monodelphis domestica} MKSKSRQGKRGRSCGSTSQRPYPGTRARASSSRTQTKVKARSRGVVTASLAAAPSASASSATAAVAATTAMATRSSPRRAAGLCKQALQGPNSFRRLLKASKVAEDPTLN
RRVTDYFPVRRSTRKNRGELRTEARIRLNELIKSGKEEGMRVGIFDGKGRGVITTRPFRRGDYVVEYHGDLIDLPMAKKREARYAKDPATGCYMYYFHYRSKGYCVDATK
ETGRLGRLINHSKSGNCQTKLHPIDGVPHLIVIATRDIEVGEELLYDYGDRSKASLEAYPWLKY*
94 >lcl|XP_001376103.1|Plus11641445..1642761 NW_001581907 c2 calcium-dependent domain-containing protein 4C-like LOC100025032 __SEG__ Chr3 {Monodelphis domestica} MKKTNMWLLDRLRGSGENGASRGADGDRSSKGPLYSNVLTPDKIPDFFIPPKLTTGPGEAEGAAAGSGSGSGSGSGSGSPHLGSSTSEQNLASGGSGPRKAQRSPRLTAK
LAAESKNLLKAASRHVIQIESAEDWHPEEEEEAVATNADPQAQTAMSLPYVPKAQTSYGFATLMESPHTRRKESLFHSEHTGLAQAGSPGALRRAKANGEGTSRAEALMS
PYRYFSGGESDTGSSAESSPFGSPLLSRSVSLLKVFAQDGQAKVSQLRHSVGRHSSLSTDDSSADVSPSARRRARRATPTGPEASGDPSSSPRGEHTVRLGKRGSLRLAA
EYDPARARLRVRLLAAEGLYDRLFDTRSINCCVGLCLTPGKLQKQRSTIIKNTWHPIFNEDFFFDGLCPSSARKLALKLKVVNKGGSLKRDTLLGEKEVPLTVLLPFL*
95 >lcl|XP_001376349.1|Plus1complement(3142398..3143831) NW_001581878 zinc finger and BTB domain-containing protein 12-like LOC100025402 __SEG__ Chr2 {Monodelphis domestica} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGIGGGIGLTGLTSTKSLLPPARTPKPAPKPPPPPPPPPLLRPVKLEFPLDEDLELKAEEEEEDEEEDVSDICIVKVESALEVAQ
RLKPPGGIGGSLGLGGSLGLGGNLNLGGGLGLGGSSGLLINEVGETIDAPDDSTAPQGVVKACYSLTEDTEGEGLLLFPGGRVGEGITLGLGDEALAAATMSRSSGVSGS
YGGIRSPIPGGSPVGNPLKNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDV
RFAHKPAIRRHLKEQHGKTTAENVLDASVSELNALLH*
96 >lcl|XP_001376363.2|Plus1complement(226023..228407) NW_001581936 kelch domain-containing protein 7A-like LOC100025422 __SEG__ Chr4 {Monodelphis domestica} MSDSRAEPGAWHSDMQFTGKLVLSATALLLGTLVYKLYKSRPARNPPAGGTAAPDAPAPEEPEVAGQAEPARTSPTAHRRRRRGSREEGAKGAPPPEGAGGAWDRRGLGG
TRPGAAPDREEPIPGEFPAGDRVEEKAVGPGKHDLPHLDDGARELENPPPGLVQAHSEAACPGDARPAPGLLLERAGGPREEEELWGAPCPGDMERSWVFSQAAGVSQER
RGLLRATSDLGLAVSQRAGEAGTSYVFSSQARAQVEENWLGEQTPGERARGQREASAGPGLRGKIYDYYVESTSRSISSPSGGPGGAVVPQGSPQLPTFGRLPSQPPADF
PDADCLTSPGRTHPAGAAEAVSESSSSSGNPFPPPGPGISRKESFLQIAENPEFQLPLDPAGASSSGALPLARRASTRSLDPNAAGAGLEPKVESVAGTNFFQLPLLPGA
AQNTRLDLGNCSEVLRLAKREKLDALKEAAYQVMSDNYLQVLQSANIYGHLSGAERELVLRRRLQGQKYLVVADVCPQEGTGRLCAYDQERDAWWPLASLPPEAISWGCS
LCSLFNYLFVVAGCPRAGGQASNRMFCYNPLTGIWREMCPLNQARPHCKLVVLDGYMYAIGGECLYTVERYDPRQDRWAFVAALPNDTFALAHTATVCDGEIYVTGGTLR
YLLLRYSGQEDRWRASPTGGGKDRTAEMVAVNGFLYRFDLNRSLGIGVYRCSARTRLWYECATYRVPYPAAFQCAVVDNLIHCVGRQFHLRFLADYVSPRFLSGDELQRF
PSPQGTLIPTVLALPALNMAQTRV*
97 >lcl|XP_001376587.1|Plus1496541..498940 NW_001581987 NF-kappa-B-repressing factor-like LOC100025746 __SEG__ Chr6 {Monodelphis domestica} MAGERLLLGDDFLSPPPPPPPQRSLPRLLQSQPQELNLEQKLEPEPEPQPQPEPPPPPEPQPQPQPEPEPERKQEVSVAEWRYSHESDRQWGLRREFISRHLQNYTGPGE
SDQLQSLSTAWTNHVFLGCKYSPQLMEKILQMAEGIHIDDIPPCEVVPESSKGQKRPISPFAGWSFTKRKAIPRIPRFEPVHFVASSKEEERRDDPMDTDAPWADPQADT
FRWPGEGPRKFGFRESRPHPAVPRMISNTGEQATSSAFQRSAFGESSLAAKLPEAMLSAKQNLIERLSATIRKNLPDPELYLGSEKMSYTFILTRCIQACKTNPEYIYAS
LKEIAPSDIPRSKKFLTDGYACEVRCQSIYLTTGYAGSKNGSRDRATEQAIKLLQKSVEVRVVRRKYRHTYQEDLVVFPTGLSSYDFPPALKPSEDLQSFKKGPAQLSSS
VIANFRQWASFVLIENASDSIGILNNSASFNRVTIEYKYDMMPNRLWRCQVFLEGQCLAEGYGSKKTSKHAAADEALTILQKTQSNITATQVQTIDYSPKGYSRKTDLKD
LVVYENSSNPVCTLNDTAQFNKMTVEYVFERLTGLQWKCKVILEKELITEAVGLKKSVKHDAAEEAVKILKRTQPTVVNNLRRGTIDTVISRNEIRGLSAEEAYQQQIKE
DNIGNQLLRKMGWTGGGLGKCGEGIREPISVKEQHKREGLGLDIERPNRISKRDIEQIIRNYARSSSHSNLTFSTEFTSDERKQIHQIAQKYGLKSKSHGMGHDRYLVVG
RKRRKEDLLYQLKQEGQVGHYELLMPQGF*
98 >lcl|XP_001376960.1|Plus1complement(41336144..41337016) NW_001581859 nanos homolog 1-like LOC100026306 __SEG__ Chr1 {Monodelphis domestica} MEAFQAVASKLPPPHHHHPHQRQHPPPMAFLQSARYVTAKSHHPHGSGSAFNSWNDYLGLATLITKAVGEEKGFGGDPASPSSSSSSSCCSPHAGAAGGMVVAAAALGPP
DDEEDDDEEAATTPYFGSALDLRDLELCGAHPADGLLEERFADFSPFSGGAGPTAAAAAAVLFDCASEPLERDRAPAWGGAAEPRLQSGPKPAGRLLKPDLQVCVFCRNN
KEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKMQAHATKQIKNARNVLGKKIR*
99 >lcl|XP_001376961.1|Plus154007466..54007885 NW_001581868 AN1-type zinc finger protein 6-like LOC100026307 __SEG__ Chr2 {Monodelphis domestica} MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTNGNVPEAQSTLDSTFSPSMQPSPVSNQSLLSDSVASTQMESTS
VDKAVPETDDLQGPRAEDLVPLECDPPCG*
100 >lcl|XP_001377473.2|Plus1<45989352..45991205 NW_001581981 kelch-like protein 13-like LOC100027066 __SEG__ Chr6 {Monodelphis domestica} SGSSGSSGSGGGEMGVSAHLQSSKAGTTRFFRSNTHSSVVLRGFDQLRGEGLLCDVSLVPGDGDDAFPVHRAMMASASDYFKAMFTGGMKEQDLKCIKLHGVNKVGLKKI
IDFIYTAKLSLTMDNLQDTLEAASFLQVLPALDFCKVFLISGVSLENCVEVGRLANTYNLTEVDKYVNNFILRNFPALLHSGEFEKLPFERLAAALASNSLKHCGELELF
KAACRWLRHEEPRMELAPKLMKNIRFPLMSPQDLINYVQTVDFMRADNTCVNLLLEASNYQMMPYMQPVMQSERTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDEKANE
WKALAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRSNKWIQVAPLNEKRTFFHLSALKGHLYAVGGRNAAGELATVECYSPRMNEWSYVAKMSEPH
YGHAGTVYGGLMYISGGITHDTFQKELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGEKLYVIGGNHFRGTSDYDDVLSCEYYLPALDQWTPIAAMLRGQSDVGVAVFEDK
IYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTIFPPEENTGSPSRESPLSAP*
101 >lcl|XP_001377560.1|Plus1complement(5861276..5863129) NW_001581878 zinc finger and BTB domain-containing protein 22-like LOC100027196 __SEG__ Chr2 {Monodelphis domestica} MEPSPLSPQGAALPLSMSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRASAATTAMATTAAVASGAGGSTGVGGTGPATTVTGSGRPHSSSRASENQSPSSSNYFSPRDSGDFSSSH
DAYSASSMGVAERRSGGGPLFSSSVMGSGSGASGKLLLEADELSDDGGDGVGVVVPGAGLRRPTYVAPSIMPQKHWVYVKRGGGCPAPAPLAPQDPDLEEEDEEEDLVLT
CEDDEDEELGGPAGGPPGGSSGPGLSISDVRTLTDPPDKGEEQVNFCESSEDFGPYESGTTGTGLDDPGGPAPSSFTSHQPRSLMPLDMQGNQLLVFPSSSQASAQPPGS
QAEHGAVTMAGSGGGNLGVSGSGGSSGGSGGGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVCGKKFMWRDSFMR
HRGHCERRHRLGGGGTPGTTGLPKREPPGGGSGDEVGGTTSPPNRRVWSPQGTHKVEMGFNGSGGGH*
102 >lcl|XP_001377599.1|Plus13527747..3528460 NW_001582023 pseudouridine-5'-monophosphatase-like LOC100027252 __SEG__ Chr8 {Monodelphis domestica} MDSPVPVLALVSPLRPVTHLLFDMDGLLLDTERLYSVIFQEICDRYGKKFTWDVKAKVMGKKELDAAQVIVEVLHLPLTKEELMAECTKKQEQVFPTTTLMPGVEKLINH
VHRHNIPIAVATSSAGLSFEWKTRRHRDFFSLFHHLVLGDDPDVKTGKPEPDLFLTCAKRFSPAPPADMCLVFEDAPNGVEAALAAGMQVVMVPDEQLNPELTRKATLVL
KSLEDFKPEVFGLPPYD*
103 >lcl|XP_001377656.1|Plus1complement(1129614..1131383) NW_001581909 ectoderm-neural cortex protein 1-like LOC100027335 __SEG__ Chr3 {Monodelphis domestica} MSVSSHETRKSRSSSGSMNIQIFHKPGHADSLLTHLNLLRQKCLFTDVVLKAGSGVFHCHRAVLASCSYYFEAMFGGGLKESREGLVDFGDRLHPEVLELLLDYAYSARV
LINEENAESLLEAGDMLQFHDIRDAAAAFLEKNLHPANCLNMLALSDAFNCERLFELSWRMALANFASLYKSEDFLKLPKVRLLELVQSEDLEVEEESLVYEAVVGWIKH
DLTARHDDLPELLRSVRLALLPEAYLKTQVAQEEVVTSHKLGGEIVADAVRCKMRLLQNDGLVTGFCARPRKVSQALLLLGGQTFMCDKIYTIDQTTNDIIPRTDIPSPR
KECSACAIGSKVYVTGGRGSENSASKDVWVYDTLHDEWAKAAPMLVARFGHGSAELAHSLYVVGGHTAVSGSFPASPSVSLKQVEHYDPQTNKWTLVAPLREGVSNAAVV
GAKKKLFVFGGTSVNQIHLPKVQCFDPCQNRWTAPTTCPQAWRYTAAAVLGSQVIVIGGDTEFSASSAYRFHSDTFQWSKFGDVTARRISCRAVTCGNRLFVVGGYCGTQ
RCKTLDCYDPTSDTWSSITTVPYSLIPTAFVSTWKYLSV*
104 >lcl|XP_001377674.1|Plus143436082..43436741 NW_001581978 GTP-binding protein Di-Ras2-like LOC100027359 __SEG__ Chr6 {Monodelphis domestica} MALDPAKPKSCVRLVFFGAAGVGKTALIQRFLADTFEAQHKRTVEELYCLEYELDTQQVRLEIMDTSGSYSFPAMRKLGIRRGDAFALVYSLQEPESFQEVRRLRAEILE
TKGEAPSPPPIVVVGNKSDLAPSGSFPNAVIAAVELEWGGIYLEASAKRGENVLSLFQELLQLVHLPSRLSPALRRRRQTFPGGPPDEAVGTVSTRRAGTRKRHSCAVS*
105 >lcl|XP_001377710.1|Plus181079274..81079621 NW_001581900 baculoviral IAP repeat-containing protein 5-like LOC100027413 __SEG__ Chr3 {Monodelphis domestica} MSGISTFQNWPFMEDCTCTPEKMAEAGFIHCPSENEPDLAQYFFCSKELEGWEPEVMLEHKKHSSICDFIGIKKKIEYLALNEFLKLEKERAKNKIEKESSQKIISFEAG
NESME*
106 >lcl|XP_001377748.1|Plus12906547..2907062 NW_001581916 RNA-binding motif protein, X-linked 2-like LOC100027466 __SEG__ Chr3 {Monodelphis domestica} MNSLTKVKLINELNEREVELGVAEKVSWHAEYKDSAWVFVGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIRGRTIRVD
HVANYRPPQDSRHVGDVVRSIQEKGCGVKTPSPAFPESSEDERPLRKHKKAKKREKNEGKL*
107 >lcl|XP_001377756.1|Plus1complement(67007278..67008444) NW_001581835 WD repeat-containing protein 89-like LOC100027479 __SEG__ Chr1 {Monodelphis domestica} MEKIEEHFAKLSVARRSAATKEPTYLLDIDTSKNVQEESGCIVAVSCSNGSIRLYNKETLSLLRELNKQPGFFNGVKFSHSNPHVFSACTDGTVKCWDIRLSGISPVQMF
KGYPSNVLISFDINCNDHIICAGTEKFGEDTVMIFWDGRMSSQSTGPFRPPLGVYSESHSDDITKVRFHPTDPNILLSGSTDGLMNVFDISIDNEDEALIATCNSGSSVS
YVGWAGKKYKEVYCLTHDEGFCWWDLTNLDSDQPIPCLNIPDVRRMIKVQNGNLDYMIGGIYHEKADQLLVVGGSNTGTIHFITSGLSGLKYMKSLEGGHSAIVRSFCWN
MQDDSLLTGGEDAQLLLWKPGATERNLAKKDRMKIASSLHKRVKVHSHDFYKNKKKYI*
108 >lcl|XP_001377779.1|Plus13115914..3116510 NW_001581916 RNA-binding motif protein, X-linked 2-like LOC100027506 __SEG__ Chr3 {Monodelphis domestica} MNSLTKVKLISELNEREVELGVAEKVSWHAEYKDSAWVFVGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTRKSKGFCFLCYEDQRSTILAVDNFNGIKIRGRTIRVD
HVANYRPPQDSRHVGDVVRSIQEKGCGVKTPSPAFPESSEDERPLRKHKKAKKEEKMKENDEYERSCSNRETRSAKFHKEKPGKKTKS*
109 >lcl|XP_001377980.1|Plus1complement(344907..346700) NW_001581921 hypermethylated in cancer 2 protein HIC2 __SEG__ Chr3 {Monodelphis domestica} MELPNYAKQLLVQLNQQRAKGFLCDVIIVVENALFRAHKNVLAASSVYFKSLVLHDNLIHLDTDMISPTAFRQVLDFMYTGRVLPAESPAEPNFHTLLNAANYLQLPELA
ALCRRKLKRPGKSFGSGRAGLPGVGRPGRGQRLSTASVIQARYPASEGRKAALAPKELPQSKGSDDELFLGGQENSHPLSRMGCKNGGGGDGASCGGSSGHSGGSEQELG
LDLSKKSPPLPPSAPGPLLGPDDLAQLSDSQHDSPAPASTNSASYPEPSGPLEDPMEVEGSGGPEENHLGLLEGPGAPPRKSLRHLARKKEWSKAEAVACASFERKEAAG
GKSCCPGDEDELDDGLPNGILGSSAGPYGEPPYPCKEELENGKELSDDSGQSDGEGPGGPAGAGPGGAGANYVYRQEGFEAVPYGDNLYVCIPCGKGFPSSEQLNAHVET
HTEEELFIKEEGGYGAGPAPEDEAEDLSAPSPAYASAAAAANEQRPFKCSGCDKSYKDPATLRQHEKTHWLTRPFPCSICGKMFTQRGTMTRHMRSHLGLKPFACDECGM
RFTRQYRLTEHMRVHSGEKPYECHLCGGKFTQQRNLISHLRMHTSPS*
110 >lcl|XP_001378099.1|Plus166561859..66562551 NW_001581989 n-acetyltransferase 8-like LOC100027946 __SEG__ Chr7 {Monodelphis domestica} MAWEFGEAGGFMLREFQPGDADEVRELFTEGMSEYGPALCVHVLQQPWVMLTLTGAFLLLVASSHSLLLPVLLLALMLAASHLVLGQVWALYIRRCLSQDLMDIGEAYSP
QRGARFWVAEARGQIVGMVGARPAEGQGASGVLVLKRMVVRQDYRGRGVGKALGRAVLAFACEQGSRAVMLVTHRLQREARNLYLSLGFRPEAPQPLPTFYGRLADFTLT
RYRYDLAPGD*
111 >lcl|XP_001378584.1|Plus1complement(49145040..49145792) NW_001581981 n-acetyltransferase 6-like LOC100028588 __SEG__ Chr6 {Monodelphis domestica} MASSSSLASCPGFEGLTLEPAHLRPELLDACADLINQEWPRSRASRLHSLGQSSDSFPLCLALLGPPPSPGALPTVLGHSRLSRVAAHDHSLLVETVVVARALRGQGFGR
HLMEATEAFAKARGFRRLHLTTHDKQHFYAHLGYKLGEPVQGLTFSSALTSSILQAFSQPASTPEPKPPSPCRKTSGSSCLTNSHPGPNLPPAPPPPPPLPAHYLSPPAL
SPTGTPQQSLLETPYRDIRGRPIFWMTKEI*
112 >lcl|XP_001378956.1|Plus148391986..48392639 NW_001581978 LDLR chaperone MESD-like LOC100029112 __SEG__ Chr6 {Monodelphis domestica} MAASSQLWLLLAFLCASDLLQYLISAKEATKEETQPPLLQKKKKNILQYNDEDMEQLLKQWEKDDVLEEWELPQQRKPLDTSQAAPGKPDSVLKMTKKGKTLIMFATVSG
NPTKKETQEIGGLWQWSLFNANYNLQRVTVGTDVVIFMLPDGSKAWEIKEFLVNQDRCADVTLQGRVYPGKGGSKNQTKASVKKKEADEKTRSFKEVSRGIRRRDDL*
113 >lcl|XP_001379849.1|Plus1111645750..111646610 NW_001581900 poly(U)-specific endoribonuclease-like LOC100030304 __SEG__ Chr3 {Monodelphis domestica} MGGGGRGPPAYRLVLNHELSKLFNQLWDADLNLLGPGRDYAISLQGKADFVPQGIHKAPDHASQALFLWVNEGRLQSTKTFAGVAENLTLEEEAENNRFLDAILETEVMN
LAHQYLVRKNLSKPSQRDFKAQLYSIWFQLYTRDGRQGPDSCGFEHVFVGETRQGQEILGFHNWVQFYLQEKRGNIDYKGYVARQHKSRPDEDDQVLNLQFSWKGLVKPV
GSTFLGVSPEFEFALFTIVFLQSQEKVTRVLVGIEEYELQIVVYHQGHHIGSAYPKLVSSNNEDLY*
114 >lcl|XP_001380141.1|Plus1complement(12075943..12076947) NW_001581988 WD repeat-containing protein 5-like LOC100030698 __SEG__ Chr7 {Monodelphis domestica} MATEEKKAEAEATETQLTPSSSTNQSKPAPAKPNYALKFTIAGHTKPVSLVKFSPNGEWLASSSADKLIKVWGAYDGKFEKTVSGHKLGISDVAWSSDSNLLVSASDDKT
LKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRLWDVKTGKCLRTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV
KFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDYLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW
KSDC*
115 >lcl|XP_001380370.2|Plus1931031..938329 NW_001581954 interferon-induced very large GTPase 1-like LOC100030998 __SEG__ Chr4 {Monodelphis domestica} MSTPRDNAIDPHHEDPGIRDLEKMLQEVGLNPQYWVSKLQENLDVTSVQALQHLEQREVLTLKSQSKHPWEKRAIERLLQLSRTQGSWEMQEKSWVQVQERQNQAQSALI
ELKEMQVEGKSRQEEIVRMKEEELRQVMEIPPEYWPLTKKPLTEVIENMKEHLSVMEGTLSNRENLPDRELLKRVSGGLALQGIYQTGQPVDLLERREELLSLPENIFLL
SPEQGTRTETKEFSSSHEESMFTQSMERLGFTVSFLAKGGGWGWSLESSTNNTKSSDSRELHKEHSENTYSCTTRFSYIPLACCHFSQDQLCLSRSAVQELKQLEKLLIH
SNDSETHILRQRCEAFFHRFGSHVNQGPLHLGGIFWWKAITKGFQSEELHDVKQQASKALDVYIGGSYSGFGVTVGAGMNISNSQSQMTSHNTDSTNLQGRFQLSVYQTG
GPPEVDSLPQWKAGLVASNCTWCVIDRGYQLVPVWDIILSNHRQDFQDPLQLTHCLTDTYTALTGKHARTQVGEEFLSAIDDAMSFLEEVKSWETTEPQEKLMKLMDFMQ
NLSEKTRNYDPWINICLKNPSLQQFLVDIYNFYKDFPIHEVKFIKSQLRSLLYPHVYQVKDFSQSHSIMQWIFQSAKQQQHIQVTEFDDFIQLLEKEKNNLLDVNPNLEF
LGQMEEARRKATYKISSFLSSFLKTLKQSGESGTYLLLLSIAVGAGYKEENQTFHYLLGCEELNFLLCEMKEAHEKYQNLNKKCGSMAQAFLLFTGLTVTPGPISVSSEK
KKQRLELMQSLTGLSWSKEVLHVLSKPRAGHDWETLEKDLNLLISGEYEVILNCVQMDQVRKELESVSQRKKKLCEPEPVTIKQHEVINSTFLELAKRLDLASYYPRKMG
RADFHLIYKTSVHDTQPDKEIQLPFYFLQKLLMLDYRLRYLVCKIEGDTMTGQTVTLRNLEDDTSDPYDDLFNDSDMSSDVLTTDQPHIHPMDIQMMIFHCADDFMRQYI
SNKLSICQFALPLVVPNPSNSVIEFPLWSFSQIKRNWRQIEKSEGKDKVINFHNQSIFQVPIPIVSFIRVVNSATSSKSQILNSLLSKHKHDTFFHRHCRGSSKSCLLMG
GVVEISWFFPGGRGEDRFESCVAFTNLHGDAKDYETQLRFLQEIASVTVVLVSASDKSERTTKMVRDLWKSSKPLVYLFDDKDKTTSNDSGLKVRIGIRNRNEAELIDQL
TSVINRLLKSSGPFLSLEDCADVARRYGFLVDLDREECQEAKGKAESLMALMKEMKLSEMKETLLPLQGELWHQWCKKDKELCHLREKGNRSLEQHKSEIETEKQIIRQT
QLKRAFPLNDLMRSVLEVLQSHSERDNKTQLYFLQWLDMFMDTLTKSHLEMLYKRHKQLFSQSLAENQKGSKDVSLKYHQMELETVSKEIRDSSLGIAHILREVGQIYEA
LEEVSSQRHTVFFSLPQIAADLMVSGYPLELMDGDASYVPLKWVSAVFDRLIEKIGDKKLFVLSVLGLQSTGKSTLLNAMFGLQFNVSAGRCTRGAYIQLVKVEETLQEE
MGFDFVLVVDTEGLRAPELMNKSQNRDNELATFVIGLGNLTLINIFGENPSEMQDILQIAVQAFLRMKQVNISPSCLFVHQNVGEMTAKDQNMEGRRRLQERLDEMAVTA
AEQEQCTDITCFSDVIWFDVNTQVHYFAHLWEGDPPMAAPNPTYSHNIQDLKKGVLLAAKEESKGSILKISEVKVRIQDLWKALVNENFIFSFKNTREIMAISKLETMYN
NWSWQLRSHLLVLENQLVNQIQNGEILDLTRSSIEANVAEKYEAIRQELQRYFDEDQDNEILIQWKGNFENKFRNLKEALVSEITRKSIDFLSSRTSQDKLDKKKSEYEK
QLLLRSRDVALLVMGKELDEDELREKFNQLWTMWVCEVSSSSSTAENLNIDVDLENVFLDHFKQEHNVRSKLQACSRKKTFSIEYEKHVKMKKKYHLYTPSIADSDKVII
NQTTQDIISLVKETIESNSKMGRDYNKSYFHEILRLIDKETDSASNKSRYTYTSEYKMDLSLYLCQRAAAIFWDMHKAFKRAHDPVTYLESKREDFFMSFKISCQGATSI
TTFADFLGNKLTASLPIAIWKKAALDLAGEIRANCPAFNGNRSNLEKHILISLANEENFVHYWQYIHQPEGFFKNYIKKEIEAYCGNRGTDKLNDVLSYNLNYFKNIIFS
AIQESTLAAKDQNNSACVWLDTLCNKLGCYLTFPRGDLRSIEHQKITDIDFLREAMNERLDSAIQKVGEACEVVFIERVVPEIQVILSEQLSGCWKQCPFCKAICTNTVK
DHSEDHSVPFHRLRAVNGGHWHNTDEFSLGFCTSYVASDVSFYRSRDEDKTFPYKTYRQAGGEYATWSITPDTSAQPYWKWFVCHFRTQLEEQYKFRFKGGGQIPDSWTR
ITKQDVLNDLNK*
116 >lcl|XP_001380380.1|Plus1997656..1004954 NW_001581954 interferon-induced very large GTPase 1-like LOC100031012 __SEG__ Chr4 {Monodelphis domestica} MSTPRDNAIDPHHEDPGIRDLEKMLQEVGLNPQYWVSKLQESLDVTSVQALQHLEQREVLTLKSQSKHPWEKRAIERLLQLSRNQGSEEMQEKSWVAVQERQKRAQSALL
ELKEMQVEGKSRQEEIVRMKEEELRQVMEIPPEYWPLTKKPLTEVIENMKKHLSLMEGTLSNRENLPDRELLKQVSGGLALQGIYQTGQPEDLLERREELLSLPENIFLL
SPEQGTRMETKEFSSSHEESMFTQSMERLGFTANFLAKGGGWGLSLESSTNNTRSSDSRELHKEHSENTYSCITRFSYIPLACCHFSQDQLCLSRSAVQELKQLEKLLIH
SNDSETHVLRQRCEAFFQRFGSHVNQGPLHLGGIFWWKAITKGFQSEELHDVKQQASKALDVYIGGSYSGFGVTVGAGINISDSQSQMASYNTNSTNLQGRFQLSVYQTG
GPPEVDSLPQWKAGLVASNCTWCVIDRGYQLVPVWDIILSNHRQDFQDPLQLTHCLTDTYTALTGKHARTQDGEEFLSAIDDAMSFLEEVKSWETTEPQEKLMKLMDFMQ
NLSEKTRNYDPWINICLKNPSLQQFLVDIYNFYKDFPIHEVKFIKSQLRSLLYPHVYQVKDFPQSHSIMQWIFHSAKQQQHIQVTEFDDFIQLLEKEKNNLLDVNPNLEF
LGQMEEARRKATYKISSFLSSFLKTLKQSGESGTYLLLLSIAVGAGYKEKNQTFHYLLGCEELNFLLCEMKEAHEKYQNLNKKCGSMAQAFLLFTGLTVTPGPISVSSEE
KKQRLELMQSHTGLSWSKEVLHVLSKPRAGHDWETLEKDLNLLISGEYEAILNGVQMDQVKKELESVSQRKKKLCEPESVTIKQHEVINSTFLELAKRLDLARYYPRKMG
RADFHLIYKTSVHDTQPDKEIQLPFYFLQKLLMLDYRLRYLVCKIEGDTMTGQTVTLRNLEDDTSDPYDDLFNDSDMPSDILTTDQRHIHPMDIQMMIFHCADDFMRQYI
SNKLSICQFALPLVVPNPSNSVIEFPLWSFSQIKRNWRQIEKSEGKDKVINFHNQSIFQVPIPIVSFIRVVNSATSSKSQILNSLLSKHKHDTFFHRHCRGSSKLCLLMG
GVVEISWFFPGGRGEDRFESCVAFTNLHGDAKDYETQLRFLQEIASVTVVLVSASDKSERTTKMVRDLWKSSKPLVYLFDDKDKTASNDSGQKVRIGIMNRNEAELIDEL
TSVINRLLKSSGPFLSLEDCADVARRYGFLVDLDREECQEAKGKAESLMALMKEMKLSEMKETLLPLQGELWHQWCKKDKELCHLREKGNRSLEQHKSEIETEKQIIRQT
QLKRAFPLNDLMRSVLEVLQSHSERDNKTQLYFLQWLDMFMDTLTKSHLEMLYKRHKQLFSQSLAENQKGSKDVSLKYHQMELETVSKEIRDSSLGIAHILREVGQIYEA
LEEVSSQRHTVFFSLPQIAADLMVSGYPLELMDGDASYVPLKWVSAVFDRLIEKIGDKKLFVLSVLGLQSTGKSTLLNAMFGLQFNVSAGRCTRGAYIQLVKVEETLQEE
MGFDFVLVVDTEGLRAPELMNKSQNRDNELATFVIGLGNLTLINIFGENPSEMQDILQIAVQAFLRMKQVNISPSCLFVHQNVGEMTAKDQNMEGRRRLQERLDEMAVTA
AEQEQCTDITCFSDVIWFDVNTQVHYFAHLWEGDPPMAAPNPTYSHNIQDLKKGVLLAAKEESKGSILKISEVKVRIQDLWKALVNENFIFSFKNTREIMAISKLETMYN
NWSWQLRSHLLVLENQLVNQIQNGEILDLTRSSIEANVAEKYEAIREELQRYFDEDQDNEILIQWKGNFENKFRNLKEALVSEITRKSIDFLSSRTSQDKLDKKKSEYEK
QLLLRSRDVALLVMGKELDEDELREKFNQLWTMWVCEVSSSSSTVENLNIEVDLENVFLDHFKQEHNVRSKLQACSRRKTFSIEYEKHVKMKKKCYFYTPSIADSYKVII
NQTTQDIISLVKETIESNSKMGRDYNKSYFHEILRLIDKETDSASNKSQYTYTSEYKMDLSLYLCQRAAAIFWDMHKAFKRAHDPVTYLESKREDFFMSFKISCQGATSI
TTFADFLGRKLTASLPIAIWKKAALDLAGEIRANCPAFNGNRSNLEKHILISLAKEENFVHYWQYIHQPEWFFKDYIKKEIEAYCGNRGTDKLNDVLSYNLNYFKNIIFS
AIQESTLAAKDQNNSACVWLDTLCNKLGCYLTFPRGDLRSIEHQKITDIDFLREAMNELLDSAIQKVGKVCEVVFIERVVPEIQVILSEQLSGCWKQCPFCKAICTNTVK
DHSEDHSVPFHRSRAVNGGSWHNTDEFSLGFCTSYVASDVSFYRSSDEDKTFPYKTYRQAGGKYATWSITPDTSAQPYWKWFVCRFRSQLEEHYKFRFKGGGQIPDTWTR
ITKQDVLNDLNK*
117 >lcl|XP_001380385.1|Plus11068150..1075430 NW_001581954 interferon-induced very large GTPase 1-like LOC100031017 __SEG__ Chr4 {Monodelphis domestica} MSTPRDNAIDPHHEDPGIRDLEKMLQEVGLNPQYWVSKLQENLDVTSVQALQHLEQREVLTLKSQAKHPWEKRAIERLLQLSRNQGSEEMQEKSWVAVQERQKRAQSALI
ELKEMQVEGKSRQEEIVRMKEEELRQVMEIPPEYWPLTKKPLTEVIENMKEHLSVMEGTLSNRENLPDRELLKRVSGGLALQGIYQTGQPADLLERREELLSLPENIFLL
SPEQGTRMETKEFSSSHEESMFTQSMERLGFTVSFLAKGGGWGWSLESSTNNTRSSDSRELHKEHSENTYSCTTRFSYIPLACCHFSQDQLCLSRSAVQKLKQLEKLLIH
SNGSETQGLRHRCEAFFQRFGSHVNQGPLHLGGIFWWKAITEGFRSEELHDVKQQASKALDIYIGGSYSGFGVTVGAGINISDSQSQMASYNTNSTNLQGRFQLSVFQTG
GPPEVDSLPQWKAGLVASNCTWCVIDRGYQLVPVWDIILSNHRQDFQDPLQLTHCLTDTYTALTGKHARTQVGEEFLSAIDDAMSFLEEVKSWETTEPQEKLMKLMDFMQ
NLSEKTRNYDPWINICLKNPSLQQFLVDIYNFYKDFPIHEVKFIQSQLRSLLYPHVYQVKDFSQSHSIMQWIFHSAKQQQHIQVTEFDDFIQLLEKEKNNLLDVNPNLEF
LGQMEEARRKATYKISSFLSSFLKTLKQSGESGTYLLLLSIAVGAGYKEKNQTFHYLLGCEELNFLLCEMKEAHEKYLNLNKNCGSMAQAFLLFTGLTVTPGPISVSSEE
KKQRLELMQSLTGLSWSKEVLHVLSKPRAGHDWETLEKDLNLLISGEYEAILNGVQMDQVKKELESISQRKKKLCEPEPVTIKQHEVINSTFLELAKRLDLEPYYPRKMG
QADFHLICKTSVHDTQPDKENQLPFYFLQKLLVLDYRLRYLVCKIEGDTMTGQTVTLKNLDDDTSDPYDDFFNDSATSSDLLTTSQPHIHPMDIQMMIFHCADDFMRQYI
SNKLSICQFALPLVVPNPFNSVIEFPLWSFSQIKRNWRQTEKSEEDKVINFHNQSIFQVPIPIVSFIRVVNSATSSKSQILNSLLSKHKHDTFFHRHCRGSSKFCLLMGG
VVEISWFFPGGRGEDRFESCVAFTNLHGDAKDYETQLRFLQEIASVTVVLVSASDKSERTTKMARDLWKSSKPLVYLFDDKDKTASNDYGQKVRIGIMNRNEAELIDQLT
RVINRLLKSSGPFLSLEDCADVARRYGFLVDLDREECQEAKGRAETLMALMKEMKLSEMKEKLLPLQGELWHQWCKKDKELCHLREKGNRSLEQHKSEIETEKQIIRQTQ
LKRAFPLNDLMRAVLEVLQSHSERDNKTQLYFLQWLGIFMDILTKSKPEMLRHKPLWSQPLAENQKGSKDVPLKCHKMELETVSLFGIEHILREVGQIYEALEEVSSQRH
TVFFSLPQIAADLMVSGYPLELMDGDASYVPLKWVSAVFDRLIEKIGDKKLFVLSVLGLQSTGKSTLLNAMFGLQFNVNAGRCTQGAYMQLVKVDETLQEEMGFDFVLVV
DTEGLRAPELMNKSQNRDNELATFVIGLGNLTLINIFGENPSEMQDVLQIAVQAFLRMKQVNISPSCLFVHQNVGEILAKDQNMEGRRRLQERLDEMAVTAAEHEQCTDI
TCFSDVIRFDVNTQVHYFAHLWEGDPPMAAPNPTYSHNIQDLKKGVLLAAKEESKGSILKISEVKVRIQDLWKALVNENFIFSFKNTREIMAISKLETMYNNWSWQLRSH
LLALENQLINQIQNGEIQDLTRSSIEANVAEKYEAIRQELQRYFDEDQDNEILIQWKGNFENKFRNLKEALVSEITRKSIDFTCLRKSQDKLDKMKSEYEKQLLLRSRDM
ALLVMGKELDEDELREKFNQLWTMWVCEVSSSTSSTSENLNIDVDLENVFLDHFKQEHNVRDRLQAFSRRKIFSIDYEKHVKMKKKYHSCHTPSIAESDKVIIEQTTQDI
MSLVNKTIKCNSKMGRDYNKSYFHEILQLIEKETDSASNKSRYTYTSEYKMDLSLYLCQRAATTFWDMHKAFKRAHDPVTYLESKREDFFMSFKISCQGATSITTFADFL
GNKLTASLPIAIWKKAALDLAGEIRANCPAFNRNRSNLEKHILISLAKEENFVHYWQYIHQPEWFFKDYIKKEIEAYCGNRGTDKLNDVLSYNLNYFKNIIFSAIQESTL
AAKDQNNSACVWLDTLCNKLGCYLTFPRGDLRSIEHQKITDIDFLREAMNERLDSAIQKVGEACEVVFIERVVPEIQVILSEQLSGCWKQCPFCKAICTNTVKDHSEDHS
VPFHRSHAVSGFHFRYSHEFSLDFCTSYVASDDSFYRSYYELDKTFPFKTYRQAGGKYATWSITPDTSAQPYWKWFVCRFRSQLEEHYKFRFKGRGQIPYTWTRITKQDV
LNDLNK*
118 >lcl|XP_001381166.1|Plus116907859..16908785 NW_001581866 tumor-associated calcium signal transducer 2-like LOC100032064 __SEG__ Chr2 {Monodelphis domestica} MAQTLVLAWLLVAAAGWTAAQNCTCPTNKWTVCNQVGASCQCTVLGSSHVVDCSTLTSKCLLMQARMRPNKPRRLINPSEHAVVDNDGLYNPDCDSGGRFKARQCNQSDV
CWCVNSVGVRRTDKGDQTLKCDELVRTSYILINLRHQERAQAFNHSDLSRALRRLFQERYQLSPKYITAVEYEQPTIQIELQQNATQKAHGEVDIADVAYYFERDIKGES
VFHNRHLNLEVRGEPLRVEDTMIYYVDEKPPEFSMKRMTAGLIAVIVVVALAIVAGVVVLIISNKRKSGKYEKVEIKEMGEMNKRLNL*
119 >lcl|XP_001381375.2|Plus1complement(20263194..20265005) NW_001581866 pre-mRNA-splicing factor CWC22 homolog LOC100032341 __SEG__ Chr2 {Monodelphis domestica} MAHMKQNSGQERRGLPQRSSFPEKEDQGRSPLDRDYREKCRRYTEIAATQRSPAHEEPPTKRKKEDVDPLLIHTGGAYIPPAKLRMMQEQVTDKNSLAYQRLSWEALKKS
INGLINKVNRSNIGIIIQDLLQENIVRGRGLLSRSILQAQNASPVFTHVYAALVAIINSKFPNIGELILKRLILNFRKGYRRNDKQLCLNATKFIAHLMNQEVAHEVLCL
EMLTLLLERPTDDSVEIAIGLLKECGLKLTEVSPRGIHAVFERLRNILHGSEIDKRVQYMIEVMFAVRKDGFKNHPVIVEGLDLVEEEDQFTHMLPLEDDYDTEDALQVF
KLDPNFMENEEKYITIKKEILNEGDSDSSTDQDATSSEDEEEEEEQVGDEEGQKVIVLDKTEINVVSFRRAIYLAIQSSLDFEECAHKLLKMEFPDSQMKELCNMILDCC
AQERTYVKFFGLLAGRFCMLKKEYMASFEGIFKEQYDTIHRLATSQLRNVAKLFAHLLYTNSLPWSVLECITLSEETTTSSSRIFIKILFQELCEYMGLPQLNARLKDET
LQPFFEGLLPQDNPRNTRFAINFFTSIGLGGLTDDLREHLRGGRVGAAPGPLV*
120 >lcl|XP_001381640.1|Plus1166399648..166400634 NW_001581902 WD repeat-containing protein 5-like LOC100032688 __SEG__ Chr3 {Monodelphis domestica} MAKTEKNVSIDVGKSLATNEKKSFKLKKPNYQLKFTLDGHTRAISAVKFNPKGNWLASSSDDKEIKIWEVYSGTYMKTLTDHNLGISDIAWSSDSELLVSASDDKTLKIW
NVGAGKCTTTLTGHTDFVFCCNFSPQSDIIYSGSFDENVRIWNVKTGGCLRCLSTHSAPVTAVHTNQNGSLLVSGSYDGLCRIWDTVSCQYIKTFMSDNCPPVSFVKFSP
NGENILTATMDNTLNLWDLKKEKCLKKYIGHKNEKYCIFADFSDTDPKLIVSGSEDNLVYVWNLETEEIVQKLQGHTDIAISTACNPKLKIIASAALEKDKTIKLWEK*
121 >lcl|XP_001381897.1|Plus1186040052..186040795 NW_001581879 EF-hand domain-containing protein D1-like LOC100032994 __SEG__ Chr2 {Monodelphis domestica} MASQELTLKLHRRLRLEQEAEVIRIPQQNGLYAVPAPAWPCGSPSQGNKLPAEELMAKVGAELKEQLNRRQGIHKGTARLPPIKVFKLYTEFPEFSHRQIKDMESLFRRY
DSGKDGYIDLMQLKLMMEKLGAPQTHLGLKEMIRKVDEDLDSKLSFREFLLIFSKAASGGLGSEISLISLAKLSEINVAIEGVKGAKNFFEAKVYDLSMTSRFEAEIKAE
QNARKQEAEDRKQRRALFRERRAAFSQ*
122 >lcl|XP_001381898.1|Plus1186064595..186065338 NW_001581879 EF-hand domain-containing protein D1-like LOC100032995 __SEG__ Chr2 {Monodelphis domestica} MASQELTLKLHRRLRLEQEAEVIRIPQQNGLYAVPAPAWPCGSPSQGNKLPAEELMAKVGAELKEQLNRRQGIHKGTARLPPIKVFKLYTEFPEFSHRQIKDMESLFRRY
DSGKDGYIDLMQLKMMMEKLGAPQTHLGLKEMIRKVDEDLDSKLSFREFLLIFSKAASGGLGSEISLISLAKLSEINVAIEGVKGAKNFFEAKVYDLSMTSRFEAEIKAE
QNARKQEAEDRKQRRALFRERRAAFSQ*
123 >lcl|XP_001381901.1|Plus1complement(186107825..186108568) NW_001581879 EF-hand domain-containing protein D1-like LOC100032998 __SEG__ Chr2 {Monodelphis domestica} MASQELTLKLHRRLRLEQEAEVIRIPQQNGLYAVPGPAWPCGSLSQGNKLPANELMAKVGAELKEQLNRCQGMHKGTARLPPIKVFKLYTEFPEFSHRQIKDMESLFRRY
DSGKDGYIDLMQLKMMMEKLGAPQTHLGLKEMIRKVDEDLDSKLSFREFLLIFSKAASGGLGSEISLISLAKLSEINVAIEGVKGAKNFFEAKVYDLSMTSRFEAEIKAE
QNARKQEAEDRKQRRALFRERRAAFSQ*
124 >lcl|XP_001381903.1|Plus1complement(186285246..186285989) NW_001581879 EF-hand domain-containing protein D1-like LOC100033000 __SEG__ Chr2 {Monodelphis domestica} MASQELSLKLHRRLRLEQEAEVIRIPQQNGLYAVPAPAWPCGSPSQGNKLPAEELMAKVGAELKEQLNRRQGMHKGTARLPPIKVFKLYTEFPEFSHRQIKDMESLFRRY
DSGKDGYIDLMQLKLMMEKLGAPQTHLGLKEMIRKVDEDLDSKLSFREFLLIFSKAASGGLGSEISLISLAKLSEINVAIEGVKGAKNFFEAKVYDLSMTSRFEAEIKAE
QNARKQEAEDRKQRRALFRERRAAFSQ*
125 >lcl|XP_001382197.1|Plus1191586772..191587278 NW_001581841 histidine triad nucleotide-binding protein 3-like LOC100033378 __SEG__ Chr1 {Monodelphis domestica} MAGEQSSPASGSTPSPTVEGAVAGPSGEGYDPKCVFCRIARQEEPGTQLLPCESEDLVCFPDIRPGAPHHYLVVPKRHIGNCKILKKEDTSLVEKMITVGKTVLQQKNIT
NLSDVRMGFHWPPFCSIGHLHLHVLAPASQMGFLSRLIYRHNSYWFITADQMMERLQA*
126 >lcl|XP_003339490.1|Plus1complement(64551483..64552484) NW_001581835 WD repeat-containing protein 5-like LOC100617313 __SEG__ Chr1 {Monodelphis domestica} MATEKKPESEARKTPPTPSSSTNQSKPAPVKPNYTLTFTLVGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKCEKTISGHKLEISDVAWSSDSNLLVSASDDKTL
KIWEVSSGKCLKTLKGHSNYVFCCNFNPLSNLIVSGSFDESVRIWEVKTGQCLKTLPAHSDPVTAVHFNSDGSLIVSSSYDGLCRIWDTASGQCLKTLIGHDNPLVSFVK
FSPNGKYILAATLNNILKLWDYSKGKCLKTYTGHKNEKYCIFANFLVTGGKWIVSGSEDNLIYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTVKLWK
SDC*
127 >lcl|XP_003339587.1|Plus179917536..79918804 NW_001581837 pre-mRNA-splicing factor RBM22-like LOC100619588 __SEG__ Chr1 {Monodelphis domestica} MAMSLGSNTYNRQNWEDSDFPILCQTCLGENPYVRMTKDIYGKACKICAKPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDVGLSLKDDMPKS
DVNQEYYTQNVEREISNSDGTRPVGLLGKATATSDMLLKLARTTPYYKRNHPHICSFWVKGECKRGEECPYRHEKPTNPEDPLADQNIKDRYYAINDPVADKLLKRASTM
PHLDPPDDKTITTLYVGGLGDTISEADLRNHFYQFGEIRTITVVQRQHCAFIQFATRQAAEMAAEKSFNKLILNGRRLNVKWGRSQAARGKEKEKEGTTDSGLKLEPVPG
LPGALPPPPPPPTAEEASANYFNLPPSGLPAVVNIALPPPSRIAPPSPPGFGPQVFHPMGPPPPFMPAPGPIHYPSQDPQRMGAHAGKHSSS*
128 >lcl|XP_003340107.1|Plus1complement(69947635..69948792) NW_001581861 hypothetical protein LOC100619913 LOC100619913 __SEG__ Chr1 {Monodelphis domestica} MLKPKDLCPRAGTRTFLEAMQAGKVHLARFVLDALDRSIIDCRAEQGRTPLMVAVGLPDPTLRSRFVRLLLEQGAAVNLRDERGRTALSLACERGHLDAVQLLVQFSGDP
EAADSAGNSPVMWAAACGHGAVLEFLVRSFRRLGLRLDRTNRAGLTALQLAAARGHGPCVQALTGPWGRAAAAAAARARGSTSDSPPGRPSAAPSPERRRPSPRRLPRPL
LARFARAAGGHGGEAGSGGKGSGRQRSFGNERPEFGRSMSLALGSVTEEEAARVRAAAQLPRSNSPQASGTGRWRSQELLEGKALTLIKAPGGLTPHPEGGPGRGRLGLR
RRSTAPDIPSLVGEVQGSDSGLEQEPDSLPLSLPGQQIPWQEGTEAEAVVLQAQR*
129 >lcl|XP_003340370.1|Plus1complement(2380204..2380854) NW_001581876 high mobility group protein B1-like LOC100012441 __SEG__ Chr2 {Monodelphis domestica} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFQDMAKADKVHYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAILKEKYEKDIAAYRTKGKPDVGKKGGIVKAEKSKKKKEEEEDEEDEEDEDDDEEDEEEEEEDDDDNE*
130 >lcl|XP_003340595.1|Plus1complement(1075704..1076018) NW_001581890 HIG1 domain family member 1A-like LOC100618156 __SEG__ Chr2 {Monodelphis domestica} MPSDSDVSLSTYETSGSKLAPKVKEAPFVPIGIAGFAAIVASGLHRLKCRGITKMAVHLILMRVGAQGFVVGAMTVAMLYSMFRQYWAKPKPWEERCCLRAADV*
131 >lcl|XP_003340992.1|Plus112097926..12098651 NW_001581926 BTB/POZ domain-containing protein KCTD14-like LOC100027377 __SEG__ Chr4 {Monodelphis domestica} MRLLDEIKMLIILFGYLQMSPVVELNVGGELYTTTVGTLKKFPGSKLAEIFSPSKPPWPDSQGRIFIDRPGTHFRPILEYLRSGQLPTHSISEVYREAQFYEIQPLVKLL
EDMPQMFGEQVARKQFLLRVPGYNENLELMIRIARAEAVAARCSGVVVCAVRTEEDATRCLDALQTLETDKRTVVKFGPWKASPVITDLLDCVKMDIEAQGYSVSYQPYA
AEKGFRIKSSDYFYKFIFTWW*
132 >lcl|XP_003341322.1|Plus167998783..67999496 NW_001581961 pyridoxal phosphate phosphatase PHOSPHO2-like LOC100024396 __SEG__ Chr4 {Monodelphis domestica} MKTLLVMDFDHTIIDDNSDTWIVKCAPEKKLPQELIDSYQKGKWNEYMGRVFKYLGDKSVEEGEIKKTMIKMPFTEGMLELINFIGKNKDLYDCIIISDSNTAFIDWILK
AANVDSVFDKVFTNPAVFSRDGFLILEGFHVHECDHCPKNLCKKKVLVEFIDKQSQKGVKYSQINYIGDGENDFCPITSLKKNDVAFARKGFTLYKMLSEPPQEFVPVES
SVVGWTSGTEILSYLQS*
133 >lcl|XP_003341864.1|Plus1complement(40125475..40126488) NW_001581989 abhydrolase domain-containing protein 13-like LOC100018078 __SEG__ Chr7 {Monodelphis domestica} MEKSWMLWTFVERWLLALASWSWALCRISLLPLIVTFHLYGGITLLVLIFVSIAGILYKFQDVLLYFPEQPSSSRLYVPMPTGIPHENIFIRTKDGVLLNLILLRYTGDD
STYSPTVIYFHGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIQLASENSHRISAIMVENTFL
SIPHMATTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSHSPEEMAKT
SSNVTII*