SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam R    

ID / Description / Sequence
1 >lcl|NP_001116803.1|Plus136822776..36824914 NW_876327 zinc finger and BTB domain-containing protein 1 isoform 1 ZBTB1 __SEG__ Chr8 {Canis lupus familiaris} MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVP
DCLEDIQDADCSSSKCSSSASSKQNSKMIFGVRMYEDTVARNGSEANRWCAEPSSTVNTPHNREPDEESLQLGNFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDS
CGFGFSCEKLLDEHVLTCTNRHSYQNTRSYHRIVDIRDGKDGSIKAEFGEKESSKAFSTQTDKYRGDTSQAADDSTSTTGSRKSTMESEVASEEKSRAADRKRIIIKMEP
EDIPTDELKDFNIIKVTDKDCNESTDNDELEDEPEEPFYRYYVEEDIGIKKSGRKMLKPRMSISADERGGLENMRPPNNSSPVQEDTENASCELCGLTITEEDLSSHYLA
KHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNTEEKMDMEENPDEQSEIRDMFVEMLDDFRDNHFQINSIQKKQLFKHSACPFRCPNCGQRFETENLVVE
HMSSCLDQDVFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSAGE
TICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT*
2 >lcl|NP_001124305.1|Plus131870305..31873550 NW_876307 zinc finger protein 518B ZNF518B __SEG__ Chr3 {Canis lupus familiaris} MQIKKMKDLGRQLYTTQVNNRHNSLTMSPKQPTANRATRPDRQEAQALLCQGSEAEAAMMTVATCVKCKSVHKIPLQDLKKGTGPSQKEDKYICFKCNLGVAAPHFHYVN
SNPNATPVGNKAEAISSSVSNKFKVRNFKPGKYYCDKCRFSTKDPLQYKKHTLQHEEIKFICSHCNYVSYTKGEFQRHLVKHTGVFPYQCEYCDYGAIRNDYIVKHRRRV
HERAGGKRLPKNVAKLEPKRVSTSKQNTELFKAPNPRTAFQNKSSDQLSRFSLHTNKDKMHSIMLLPESKEYQKDVVCVPNKVTLSEPNEGSLFENKSVEVEVLSPAKEP
VQPGMPLTVVAPAELVVPANCLAQLIDVKVVNGTQQLVLKLFPLEESNRPDAGGGEGGNSERMTREKRLVEPEKMVSAGQTKSLAIEGNVGKLAGIDNLQSSVQKQLKNV
KWVRSYDFFMSNSSVHDRGESLLNPDTVEDFPKKSSMYPHRPAFPSLSLKGHSPASLVKNSIFHSLGAASNPFPYKAAVSFAEDGRNLHGDLQQLLPLAASPTTMSFSGE
KGSLSVSTNNLESRNEISVPIKMVPSHRKLKDKQMEEHKAVSNTSQISSQHKSEYLHINMPGEDRIRSQPPREEPLELKNPERTKDSFDGPVISSVFSLSSGSENVPEGV
KWNSSTSKIKSIELLRRKIAQLIESCGKPSSLSANNAHRRSVGQTSKETSKAAPEGIHEINVSFTGTGYSTGTLPKPQDDGGINGQLTHQQIYPQFIEGSNGNTERVTRK
AHVATPVLIPKGAVLRVLNSSEDAHIIEATCEAPVSIPCSETQLIKPIPLCPVRQTDSDLQSLTSESGPIDMSQNFDIPLRPKPRKESSFCSTMPKKTGPLHSQQGSSEL
SKQGKLLSRSLPISKNKTKQVNSSKKKSKIQADPSRYLKDPSIFQVARQLRLVAVKPDQLIKCPRRNQPVIVLNHPDVDSPEVTNVMKVINKYKGNVLKVVLSERTRCQL
GIRRHHVRLTYQNVEEANQIKRQMMLKMKLKKVHKNNYQVVDSLPDDSSQCIFKCWFCGRLYEDQEEWMSHGQRHLIEATRDWDVLSSKGK*
3 >lcl|NP_001165219.1|Plus1complement(24549157..24551928) NW_876277 RNA binding motif protein 12 RBM12 __SEG__ Chr24 {Canis lupus familiaris} MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFIVFATDEDARLGMMRTGGTIKGSKVTLLLSSKTEMQNMIELSRRRFETANLDIPPANASRSGPPPS
SGMSGRVNLPTTVPNFNNPSPSVVTAATSVHESNKNIQTFSTASIGTAPPNMGASFGSPTFSSTIPSTASPMNTVPPPPIPPIPAMPSLPPMPSIPPIPVPPPVPTLPPV
PPVPPIPPVPSVPPMTPLPPMSGMPPLNPPPVAPLPAGMNGSGAPMNLNNNLNPVFLGPLNPVNPIQMNSQSSVKPLPINPDDLYVSVHGMPFSAMENDVRDFFHGLRVD
AVHLLKDHVGRNNGNGLVKFLSPQDTFEALKRNRMLMIQRYVEVSPATERQWVAAGGHITFKQSIGPSGQTHPPPQTLPRSKSPSGQKRSRSRSPHEAGFCVYLKGLPFE
AENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRNEADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQNFSYDQREMMLNPEGDVSSAKVCAHITN
IPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMREIEKNPPAQGKKGLKIPVPGNPAVPGMPSVGMPSA
GMPGAGMPGAGMPGAGMPGPGMPGAGMPGAGMPGAGGEEHAFLTVGSKEANNGPPFNFPGNFGGSNAFGPPLPPPGLGGAFGDARPGMPSVGNSGLPGLGLDVPGFGSGP
NNLSGPGFGGGPQNFGNGPGSLGGPPGFGSGPPGLGSAPGHLSGPPAFGPGPGPGPGPIHIGGPPGFGSSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLK
YNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG*
4 >lcl|NP_001183960.1|Plus19985522..9986127 NW_879562 ras-related protein Rab-9A RAB9A __SEG__ ChrX {Canis lupus familiaris} MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYAD
VKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVSLHRKPKPSSSCC*
5 >lcl|XP_003431558.1|Plus115371313..15372470 NW_876251 mTERF domain-containing protein 3, mitochondrial-like LOC100685274 __SEG__ Chr10 {Canis lupus familiaris} MLWKLLIRSQLCRLCSFRKMLSASKYRPSLASFTYTTDHQSNKENKRTVEKLYKFSVDIRKIRRLKGWVLFEDETYVEEVADVLQQLGADEATVASILERCPEAIVCSPT
TVNTQREVWQLVCKNEQELVKLIEQFPESFFTIKDQETQKLNIQFFQELGLKNVVIGRFLTTASNIFHNPIEKNRQMISILQESYLNLGGSEANMKVWLLKLLSQNPFIL
LNSSAAIKKTLEFLQEQGFTNFEILQLLSKLKGFLFQLCPGNIQNSISFSKNAFKCTDHDLKQLVLKCPAILYYSVPVLEERIQGLLKEGISIAQIKETPMVLELTPQIV
QYRIRKLNSLGYRIKDGHLANLNGTKKEFEANFGKIQAKKGRPLFNPVAPLNVEE*
6 >lcl|XP_003431628.1|Plus1complement(45128744..45129637) NW_876253 mitochondrial carrier triple repeat protein 1-like LOC100686420 __SEG__ Chr11 {Canis lupus familiaris} MVDSEAHEKRPPILTSSKQDLSPHIANVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLR
KHISTPEFATRSVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIREYYRGLVPVLFRNGFSNVLFFGLRGPIKEHLPTAKTHSAHLVNDFICGGL
LGAMLGILFFPVNVVKTRMQSQIGGEFQSFPKVFQKIWLERDRKLTNLFRGAHLNYHRSLISWGIINATYEFLLKII*
7 >lcl|XP_003431646.1|Plus1complement(32194928..32195308) NW_876253 cyclin-dependent kinase inhibitor 2A, isoforms 1/2/3 CDKN2A __SEG__ Chr11 {Canis lupus familiaris} MMMGSTRVAQLLLLHGANPNCADPVTLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHGAVAAYLRAAAGGTESGSHARTEGAEGHAGEVPHLSWN
SESFRSPEHSFFRRES*
8 >lcl|XP_003431694.1|Plus131762254..31764107 NW_876253 kelch-like protein 9-like LOC100688162 __SEG__ Chr11 {Canis lupus familiaris} MKVSLGTGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRVEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDFI
YTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAAC
RWLRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWRSL
APMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHA
GTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVV
GGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS*
9 >lcl|XP_003431747.1|Plus1complement(3307072..3307668) NW_876254 rRNA-processing protein FCF1 homolog LOC100683806 __SEG__ Chr12 {Canis lupus familiaris} MGKQKKARKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEI
EKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTRHKCYIVATVDRDLKQRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF*
10 >lcl|XP_003432031.1|Plus1complement(32659640..32660080) NW_876259 protein BTG1-like LOC100684605 __SEG__ Chr15 {Canis lupus familiaris} MCNSNDLSVVSLFFSSSSSSCLPIEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQ
NSSNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG*
11 >lcl|XP_003432149.1|Plus115197763..15198746 NW_876261 putative methyltransferase KIAA1456-like isoform 1 LOC482887 __SEG__ Chr16 {Canis lupus familiaris} MARVLVPGGQLMIYVWAMEQKNRHFEKQDVLVPWNRALCSQLFSDSSQPGRKQQCGHPERSHSYHPPCSICSCSVCFKEQCPSKRSHSMDYEPLMAGNCCADVSKEGEEE
NGFYNTLGKSFRSWFFSRSLDESTLRKQIERARPLKNTEGWANSTISIQPSRHSSLDLDHQEPFSIREQNLDEDVFVETSQKPLEWPRASAAVKHLHGDQQGEVRRNGDG
NFLEGAHPSDNCVNAGNVEDGNPSASKILKRISALNSTDSNPDETISVKEQQPNVLDSRAFMRYYHVFREGELYGLLKEHVAELHVLSSGNDHGNWCIIAEKKDNWD*
12 >lcl|XP_003432188.1|Plus1complement(11644292..11645188) NW_876263 syntenin-1-like LOC100688261 __SEG__ Chr17 {Canis lupus familiaris} MSLYPSLEDLKVDKVLQAQTAFSANPANPAILSEASAPISQDGNLYPKLYLELSQYMGLSLNDEEIRANMALAPGASVQGQLVARPSSMNYMVAPVTGNDVGIRRAEIKQ
GIREVILCKDQDGKIRLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKTTMTVRDRPFERTVTMRKDSTGHVGFIFKNGKITS
IVKDSSAARNGLLTELNTCEVNGQNVIGLKDSQIADILSTSETVVTITIRPAFIFEHIIKRMAPSIMKSLMDHTIPEV*
13 >lcl|XP_003432612.1|Plus138498046..38498828 NW_876270 ribosome biogenesis protein NSA2 homolog LOC100687130 __SEG__ Chr1 {Canis lupus familiaris} MPQNEYIELHQKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQMKKTIKMHEKRNTKQKNDEKTPEGAVPAYLLDREGQFRAKVLSNMIKQKR
KEKAAKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRSMGLRFKKAHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVI
EVNVSELGLVTQGGKVIWGKYAQVTNNPENDGCINAVLLV*
14 >lcl|XP_003432700.1|Plus126536073..26536672 NW_876270 GTP-binding protein Di-Ras2 DIRAS2 __SEG__ Chr1 {Canis lupus familiaris} MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGD
VESIPIMLVGNKCDESPNREVESGEAEALARKWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVVM*
15 >lcl|XP_003433054.1|Plus124385133..24385387 NW_876273 coiled-coil-helix-coiled-coil-helix domain-containing protein 8-like LOC100685149 __SEG__ Chr21 {Canis lupus familiaris} MSTQGHTWARQVKKENEEEDPLDQLISRSGCAASHYAVQECMAQHQDWRHCQPQVQAFRDCMSEQQARRREELQRRKEQGSAHH*
16 >lcl|XP_003433072.1|Plus128631463..28633307 NW_876273 ubiquilin-like protein-like LOC485274 __SEG__ Chr21 {Canis lupus familiaris} MPHVISRTPKMAQSGHSSGMPADKNISSSVTRVIVKTAGKQEDFMIADDTSVRQFKEKLSTHFKCQMDQLVLVFMGRLLKDHDTLSQRGILDGHTIHLVIKSKRSSRSLA
HSSRNLSTKEPCHQVRNTEGNTNGVYQPAGVSHTPLESALLVEPDAPKVHSQDLEVSGPEYIAQMLQNPSIQQLLSNTDLVRQFISEHPDMQQLMQQSPEVSYILDNSDI
LWQTLELARNLAMIQEIMQIQQPEQILEHPLNPQSHLGLETLPGGDNALGQSYVDCNDQMLNSSQDLFGGNPFPALLEGQVLQQLQSSPPSPPPPQERQDQLPQLPTTRV
IYTSSHGLSSITSASVTPNKVNHTPSTHTTTISTKGPSPTCPIQQPARVPALPSIELTQQPQTEDIDATISLDSSDQKLEDDLQPSDEQTKSQITGSMMQLLLNNPYLAA
QMMLFISMPQLSEQYRQQLPTFLQQTQLSDMLIALANPKASQAILQIEQGLQLLATEAPVLLPWVAPYLWGLGWLPAPSCSHPDTVPWAWDVPDIAEPKGPECCHKSGTG
LQSLQSLAGDPSHLLQAPEIRFSQQMESLQAMGFGNHHANLQALIATEGDTSAAIRKLKRSHGF*
17 >lcl|XP_003433073.1|Plus128637683..28639650 NW_876273 ubiquilin-3 UBQLN3 __SEG__ Chr21 {Canis lupus familiaris} MAKSGEALPQGNPAPIQDPRLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLILIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTMGTECPAASVPAP
ASSPGSFPQSSSIYPADMPPTFSLGVLTGLNGLGLTSSSFPDQPSSLMWQHVSMPEFVAQIIDDPFIQGLLSNTGLMRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQT
LEFLRNPAMMQEMMRSQDRALSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFATATTVNATSSSNQPSRTENCDPLPNPWASTYGSSGGRRGRHPGDQDAPETR
NRVPNILGNIGLYDYLQQLHETPQSLGTYLQGIASTLNPSQEPPPPGNRIPPTSSSSQECESGQPLPKESATIKGKSSCPSFLRYPPESNTDQYGSQSGAGNGSTSHSTN
MPDLVLGLGHSANRAPFVPSPLSSVAATLGSPEHAWLPPPAFPRSLRPTSMSQVPQLQDEMRRQLPLLLHLQAAMANPRAMHALLQIEQGLQVLATEAPRLLLWFMPCLA
GLGNMAGSTEPREGALMPEDPPLAPAPEVPPAQGSVELGLHSTPFLQMLQALVGANPQQLQPEIHFRVQLEQLRAMGFLNPEANLQALIATGGDVDAAVEKLRQA*
18 >lcl|XP_003433133.1|Plus11345819..1346832 NW_876275 abhydrolase domain-containing protein 13 ABHD13 __SEG__ Chr22 {Canis lupus familiaris} MEKSWMLWNFVERWLIALASWSWALCRISLLPLIVTFHLYGGIILLLLIFVSIAGILYKFQDVLLYFPEQPSSSRLYVPMPTGIPHENIFIRTKDGVRLNLILIRYTGDN
SPYSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFL
SIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSHSPEEMAKT
SSNVTII*
19 >lcl|XP_003433142.1|Plus1complement(2210801..>2211241) NW_876275 TP53-regulating kinase-like LOC100688975 __SEG__ Chr22 {Canis lupus familiaris} SNCLYTEEIEGSVTVRDYIQSTMETEKTPQSLLGLAKRVEQVLAQMHDEDLIHGDLTTSNMLLKPPMEQLNIVLIDFGPSFISALPEDKGVDLYVLEKAFLGTHPNTETV
FEAFLKSYTTFSKKSRPVLKKLDDVRLRERKRSVVG*
20 >lcl|XP_003433647.1|Plus19590571..9595043 NW_876285 zinc finger protein 518A-like LOC100687589 __SEG__ Chr28 {Canis lupus familiaris} MPSEQKQLFFDEKQTTFKKDYDVKNEIVDSFRSLPRPKISQSSFHYELKNVKIDLPKINIPNEVILKHEVDKYRKLFQRQPQTARKSISVRTVSCVEECMLLYKSERVEE
EGLKMSAKILNFNCLKCRDSTRYSPNDLQKHFQMWHRGELPSYPCEMCSFSANDFQIFKQHRRTHRSTLVKCDICNNESVYTLLDLTKHFASTHCVNGSFQCEKCRFSTQ
DVGTFVQHIHRHNEIHYKCGKCHHVCFTKGELQKHLHVHSGTFPFTCQYCSYGATRREHLVRHVITLHKEHLYAKEKLEKDKYEKRMAKTSGLKLILKRYRIDASRKTFW
KRKKINNGSDRSIEKNTQVLKKVNKTQAKSEDQSHLVQEHLSEGKDERPHCENNDKPAESESEKPALLSTAQCNRAEEGSNSTLGFLKTAVQGPTVLMVKNNRITIPANY
SADFMGFKMVDGKQHIVIKLLPTNKQNLYSPGSQSDAAKDSTANLQPQTLDTTGFLAGVTAELSDTVYMKATTPFSCSSPILSGKVTSEKEMALLSQMSNMLQTMDDEKN
VSSLSASELVTASVNLTTKVETKDNIDLWGSYVTQSHSEISGTTIKSPDKVTSTTKQNAYNSGDMHNYCINYVNSELPVESSNQGSLPFHNYSKVNNSNKRRRFSGTGMC
ENPQKEPSSSKTVVQQPISESVLSLVRKESSNPDSMLASISLLNTKDGTLKMQAEIEEQSVLEKGQNIDGQNLYTNENQNLDSVTEKSKWDGISNVESPMMPRITSVFSL
QSQQASEFLPPEVNQLLQDGLRAKSDVKQDCSISNTPDKGLLLHSDQSFQKLEGEGKIVESSKDFKVQGTFPVPSGSLGINVPTNDLNLKCSGKEKQNLSISQDVRDSEK
TPRISGIGTLLKTQSDAIITQQLVKDKLRATTQNLGSLYRQSPLLNSEPKKAIFVQTPKGFFVPLHIANKPGLHIVSGRPLPLVSTQGVPTSLLLNKKPGMILTFNNGKL
EGVSTVKTESAQACGTPTKESCRTPFLKVEPNSNCLTPALCSSIGSCLSMKSSSENTLSLKGPYIIKTSASSSVKAVPTPNTVSEHQGTKLNILDSVKKQNEIFPKPPLY
TLLPDGKQAVFLKCVMPNKTELLKPKLVQNSTYYQNIQPKKPEGTPQKILLKIFNPVLNVTAANNLSVSTSASSVQKDKVPSNQTIGEQREPESSRDALPFLLDDMMPAN
EIVITSTATCPESSEDPMCFTDHSDSRVLRCKTNCTIERNFNREKTSKKKFSRIKTHVRSKDSETAFVSRNRNCKRKCRDSYQEPPRKKATLHRKCKEKSKPEDARESFG
FNRPRLSKDSVRTLRLFPFSSKQLVKCPRRNQPVVVLNHPDADAPEVVSVMKTIAKFNGRVLKVSLSKRTISALLKPVCDNSSKRIYDDFSKRHKTLKPVSSVKERFVLK
LTLKKTSKNNYQIVKTTSENVLKAKFNCWFCGRVFDNQDAWAGHGQRHLMEATRDWNILE*
21 >lcl|XP_003433726.1|Plus1complement(39718302..39719051) NW_876288 pleckstrin homology domain-containing family F member 2-like LOC100684134 __SEG__ Chr29 {Canis lupus familiaris} MVDRLANSEANTRRINIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFA
VYAATATEKSEWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGDMATCQ
PARSDSYSQSLKSPLNDVSDDDDDDDSSD*
22 >lcl|XP_003434089.1|Plus132034103..32035362 NW_876297 pre-mRNA-splicing factor RBM22-like LOC487904 __SEG__ Chr32 {Canis lupus familiaris} MATSMGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMHFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKS
DVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSNMLLKLAQTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDQYYGINDPVADKLLKRASTM
PHLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGIKLEPVPG
LPGALPPPPAAEEETSANYFNLPPSGPPAVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP*
23 >lcl|XP_003434124.1|Plus1complement(13246468..13247457) NW_876299 WD repeat-containing protein 5B-like LOC100685660 __SEG__ Chr33 {Canis lupus familiaris} MATEAGEAKAESGLLSSASRSKQMPEKPNYALKFTLVGHTEAVSSVKFSPNGEWLASSSADKVIRIWGAYDGKYEKTLSGHSLEISDVAWSSDSSRLVSASDDKTLKVWD
VRSGKCLKTLKGHSNYVFCCNFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGVCRIWDAASGQCLKTLVDDDNPPVSFVTFSPN
GKYLLIATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENIIASAALGNDKTIKLWTSNC*
24 >lcl|XP_003434292.1|Plus114417986..14418711 NW_876303 pyridoxal phosphate phosphatase PHOSPHO2-like LOC100684043 __SEG__ Chr36 {Canis lupus familiaris} MKILLVFDFDNTIIDDNSDTWIIQCAPEKKLPIELQNSYKKGFWTEFMGRVFKYLGDRGVREDEMKRAVTSMPFTLGMVELLNFIRRNKDKFDCIIISDSNSVFIDWVLE
ATSFHDVFDKVFTNPAAFDSNGHLTVENYHAHSCNRCPKNLCKNVVLVEFVDKQLQQGIDYTRIVYIGDGGNDVCPVTFLKKNDVAMPRKGYTLQKTLSRMSQNLEPMES
SVIVWSSGVEIISYLQFLINE*
25 >lcl|XP_003434713.1|Plus12366532..2367572 NW_876313 protein AMAC1-like LOC100688324 __SEG__ Chr5 {Canis lupus familiaris} MPELLSPSQAGSHPYFNLPDFTQPSPPSTPPSLPSHQRCRPSDATKGLLVALLGGGLPAGFVGPFSRMAYQASHLPSLELLICRCLFHLPIALILKLRGDPLLGPPDVRG
RACLHALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTVCSALLALCLESQGLSGYDWCGLLGSTLGLIIIVGPGLGTLQEGTTGLYTALGYVLAFLGGLALSLGLLVYRS
LDFPSCLPTVAFLFGLVGLVGSVPGLFVLQTPVLPNDPLSWSCVGAVGILALVSFVCVSYAVTKAHPALVCAVLHSEVVVALMLQYYVLYETVAPSDIMGAGVVLGSIAI
ITAQNLSCEREGQVEE*
26 >lcl|XP_003434729.1|Plus1complement(6863687..6864697) NW_876315 3-hydroxyisobutyrate dehydrogenase, mitochondrial-like LOC100684376 __SEG__ Chr5 {Canis lupus familiaris} MAASLRLCAAASGLRYWSRRQRPAAASLAAVCSRSMASKTPVGFTGLGNMGNPMAKNLMKHGYPLIIYDVFPDVCKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAI
EAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGAEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISM
IGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGATLMAKDLGLAQDSATSTKSPILLGSQAHQIYRMMCAKGYSKKDFSSVFQFL
REEETF*
27 >lcl|XP_003435035.1|Plus126923942..26925039 NW_876323 histidine protein methyltransferase 1 homolog isoform 1 LOC100685478 __SEG__ Chr7 {Canis lupus familiaris} MTFQFNFTIVNHLENESVPLGDGALAVDSSKESSVSEGKHRDRKCSTEQFDLPQDHLLEHKQLGNATPSQDTDSSLTAANSSSNLEPQEEHPYIRVAKEHTVPEDLKKVL
ENKVIETLPGLQHVSVVKTILLKENFPGENIISQSFSSQSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFVGKRVLDLGCGSGLLGIVAFKGGAKEIHFQDYNSLVIDE
VTLPNVVANSTLEDKGNDVNEPDVKRCRKSEVAQELSKCRFFSGEWSEFCKLVLNSEKFFEKYDLILTSETIYNPDYYGTLHQTFLRLLDKNGRVLLASKAHYFGVGGGI
HLFQKFVEERNVFETRTLEIIDKGLKRFLIEMTFK*
28 >lcl|XP_003435193.1|Plus1complement(35994474..35995637) NW_876327 WD repeat-containing protein 89-like LOC100684919 __SEG__ Chr8 {Canis lupus familiaris} MEKIEERFANLNIVKRSTGSKEPTYLLGIDTSKTVKAEKENLVAVLCSNGSIRIYDKERLYILREFSVYPGLLNGVKFANSCDSIYSSCTDGTVKCWDARLASEKPIQLF
KGYPSNIFISFDINCNDHVICAGTEKVDDDALLVFWDARINSQDLSTTKDPLGTYSETHSDDVTQVCFHPNNPNMVVSGSTDGLVNVFDISVDNEEDALVTTCNSVSSVS
CIGWSGKDYKQIYCMTHDEGFCWWDLNHLDTDEPITCLNIQDVREVINVKEGTLEYLIGGLYHEKMDKLFVVGGTNTGTIHLMSCTTSGLIHVTSLHGGHAATVRSFSWN
TQDDSLLTGGEDAQLLLWKPGAIEKTFTKKDSMKIASSVSQRVRVHSNDSYKRRKKQ*
29 >lcl|XP_003435317.1|Plus1complement(8555543..8556580) NW_876332 protein Tob1-like LOC100683517 __SEG__ Chr9 {Canis lupus familiaris} MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVK
VLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQK
AISSSMHSLYGLGLGSQQQPQQQQQPSQPPPPPPPPQQQQQQKASALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLN
NMQYSNQQFQPVMAN*
30 >lcl|XP_003435500.1|Plus110020263..10020991 NW_879562 UPF0568 protein C14orf166-like LOC100685455 __SEG__ ChrX {Canis lupus familiaris} MFRRKLTALDYHNPADFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCLFNIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLIPNNTKNA
DNAAKNAQPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKGIRILVQERLTQDADAKANQTKEDLPVALDKHILSFDTGDAVLNEAAQILQLLHIEELRELQTKIN
EAIVAVQAIIADPKTDHRLGKV*
31 >lcl|XP_003435667.1|Plus1complement(27387646..27388053) NW_879563 high mobility group protein B1-like LOC609805 __SEG__ ChrX {Canis lupus familiaris} MKTYIPLKGETKKKFKDPNALKRPPSFFFLFCSEYRPKIKGEYPGLSIGDVAKNLGEMWNNTAADEKQPYEKKAAKLKEKYEKDIAAYRAKGKPDMAKKGVVKAEKSKKK
KEEGEAEEDEDEEEEEDEEENDDDE*
32 >lcl|XP_003435705.1|Plus143643078..43645096 NW_879563 transcriptional regulator Kaiso ZBTB33 __SEG__ ChrX {Canis lupus familiaris} MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGV
KFIAELGVPLSQVKSISGTSQDGNAETLPPGSSDKNLEIQKSKDEAQDNGATIMPIITESFSLSAEDYETKKIIVTDSDDDDDDVIFCSEILPAKDTLPSTNAVAQVQPS
PGSVAISDVAPCTSNNSPPLPNLTPTQKLPTSVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLTTPPNVTSSLPNHMSPSINLLVQNQQTPNSAVLTGNKANEEE
EEEIIDDDDDTISSSPDSAVSNTSLVPQADIPQNATFDGSLVQKMQIPTLLQEPLSNSLKISDIITRNTNDAGLGSKHLMEGQKIITLDTATEIEGLSTGCKVYANIGED
TYDIVIPVKDDPDEGEARLENEIPKTSSGEPANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRY
QCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSGAMPVMKDDAIGYKVDAGKEPAVGTTSTPQNKPMTWEDIFIQQENDSIFKQNVTDG
STEFEFIIPESY*
33 >lcl|XP_531995.3|Plus143606476..43608242 NW_876253 calicin CCIN __SEG__ Chr11 {Canis lupus familiaris} MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNVLAAVSPLVKSLISSNDMKTTDELFITIDPNYLSPATVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCNDFLIKSIRRANCLRYLFLAELFELKEVSDLAYSGIRDNFHYWASPEGCMHFMRCPPVIFGRLLRDENLHVLNEDQALSALINWVYFRKDEREKYFKKFF
NYVNLNAVSNKTLMFASNKLMGMENSSAHATLIESVLVDRKQEKPSSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATSAGRYIY
ISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEAWCLAGKMSIPMDGTAVITKGDRNLYIVTGRCLVKGYIS
RVGVVDCFDTNTGDVVQCITFPIDFNHRPLLSFHQDNILCVHSHRQSVEINLQKIKANKTTTSVPLLPNNCPLDVSHAICSIGDSRVFVCGGVTTTSDVQTKDYTINPNA
YLLDQKTGEWKTLAPPPEALDCPACCLAKLPCKILQRI*
34 >lcl|XP_532316.2|Plus1complement(18241462..18242373) NW_876255 peroxisomal trans-2-enoyl-CoA reductase PECR __SEG__ Chr13 {Canis lupus familiaris} MRSWVERRSFLAPGLLLHQLAIVTGGATGIGKAIATELLHLGCNVVIASRNFDRLKSTAEELRASLPPTNQAQVTPIKCNIRKEEEVNNLVRSTLEIYGKINFLVNNGGG
QFVAAMEHINAKGWHAVIEINLTGTFYMCKAVYNSWMKEPGGSIVNIIILTRNGYPGFTHSGAARAGVYNLTKSLAVEWASSGIRINCVAPGTIYSPSAVDNYGPLAENM
FAGYFGKIPAKRIGVPEEISSVVCFLLSPAASFITGQLVNVDGGQSLYTHIFDVPDHDNWPDGAGDISFVKHLKNTFKSKSKL*
35 >lcl|XP_532598.2|Plus121064136..21065113 NW_876257 alcohol dehydrogenase [NADP+]-like LOC475374 __SEG__ Chr13 {Canis lupus familiaris} MAASCVLLHTGQKMPLIGLGTWKSDPGQVKAAIMYALSVGYRHIDCAAIYGNEAEIGEALKENVGPGKVVLREELFVTSKLWNTKHHPKDVEPALRKTLADLQLEYLDLY
LMHWPYAFERGDNPFPKNADGTVRYDSTHYKETWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQKELIAHCQARGLEVTAYSPLGSSDRAW
RDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPDEMKQLDALNKNWQYIVPMLTVDGKRVPRDAGHPLYPFNDPY*
36 >lcl|XP_533315.2|Plus1complement(23955910..23956902) NW_876267 quinone oxidoreductase-like isoform 1 LOC476107 __SEG__ Chr19 {Canis lupus familiaris} MATAGKLMRAIRVFEFGGPEVLKLRSDVAVPIPKDHQVLIKVHACGVNPVETYIRSGTYRRKPLLPYTPGSDVAGIIEAIGENVSTFKKGDRVFTTATISGGYAEYALAS
DHTVYILPEKLDLKQGAAIGIPYFTAYRALLHSARAKAGESVLVHGASGGVGIAACQIARAYGLKVLGTAGTEEGQNIVLQNGAHEVFNHRELNYIDKIKKSVGEKGIDV
IIEMLANVNLSNDLDLLSYGGRVIVVGSRGPIEINPRDTIPKETSIIGTALYSSTKEEFRKFAMALQAGMEIGWLKPVIGPQYSLEKVVQAHENIIHSSGAIGKMILLLE
*
37 >lcl|XP_534630.3|Plus1140139..140735 NW_876282 rRNA-processing protein FCF1 homolog LOC477433 __SEG__ Chr26 {Canis lupus familiaris} MGKQKKARKYATMKRMLSLRDQRLKEKDRLKPIKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVTAEI
EKLGQKYRVALRIAKDPRFERLPCTHKETYADDCLVQRVTQHKCYIVTTVDRDLKRRIRKIPGVPIMYISNHRYNIQRMPDDYGAPWF*
38 >lcl|XP_537559.2|Plus1complement(68917806..68918408) NW_876327 ras-related protein Rap-2a-like LOC480441 __SEG__ Chr8 {Canis lupus familiaris} MAGPGPRPAKGYRVVLLGSVAVGKTALATQFACGSFPEQCEPSVEELFSKVIEVNAAPALLEIVDTVGAEHLVTLKDLYIKNSDGFVVLYSVCSEASFEAVRPLRERMGR
LRGPKAVPLVLVGTKADLDAERQVLTARGRALAREWRCPFLEVTAKSKLMVDQVFTQVVREMEALAPPEEEAPAAPPNAQDTWPSERFIG*
39 >lcl|XP_538124.1|Plus1complement(28629998..28630603) NW_879563 ras-related protein Rab-9B RAB9B __SEG__ ChrX {Canis lupus familiaris} MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYAD
VKDPEHFPFVVLGNKVDKEDRQVTTEEAQAWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC*
40 >lcl|XP_538188.2|Plus1complement(64328768..64329394) NW_879563 coiled-coil domain-containing protein 25-like LOC481067 __SEG__ ChrX {Canis lupus familiaris} MVFYFTSSSVNSSAYTIYMGKDKYENEDLIKRGWPEDIWFHVDKLSLAHVYLRLHKREKIEDIPKEVLMDCAHLVKANSIQGCKMNNVNVVYTPWANLKKTADMDVGQIG
FHRQKDVKIVTVEKKVNEILNRLEKTKMERFPDLAAEKECRDWEERNEKKAQIQEIKRKEKEEMKKKREMDELRSYSSLMKVENMSSNQDSNDSDEFM*
41 >lcl|XP_538537.1|Plus152296205..52297275 NW_876251 poly(rC)-binding protein 1 isoform 1 PCBP1 __SEG__ Chr10 {Canis lupus familiaris} MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCGDAAGYPHATHDLEGPPLD
AYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT
GSAASISLAQYLINARLSSEKGMGCS*
42 >lcl|XP_538592.2|Plus1838075..839334 NW_876252 interferon-inducible GTPase 1-like LOC481471 __SEG__ Chr11 {Canis lupus familiaris} MDKFMCDFLVGKNFQQLAINFIPHYTTLVNKAGGIIASENLDRIQAALKEAKLKDVADIIEESLVAAENAPLDVAVIGESGTGKSSFINALRGLSYEEEGSASVGVVETT
MKKTPYQHPKYPKVTFWDLPGTGTPNFHPHEYLEMVEFATYDFFIIISSSRFSLNDALLAQNIKEIGKKFYFVRTKVDNDLYNEEKSKPMSFKRERVLQQIRDNCLANLS
NIGVPEPCIFLVSNFDLDDFDFPRLEETLLKELPVHKRHIFALLLPNLSYTSIEMKRAFFKEKIWLDALKSSALSFIPFMACFNGFDFPQQEKCLNLYQSHFGLDEKSVK
GIAEKLDMSVEEIKSFTKSLDFWLLVKDDSIAEKAMKCVECYCSVNGGLPSTIFQFFKIYFLHLKFINTVADDAKILLHKTLEILSHRR*
43 >lcl|XP_538654.3|Plus118311525..18312214 NW_876253 LOW QUALITY PROTEIN: tumor protein D55 TPD52L3 __SEG__ Chr11 {Canis lupus familiaris} MDPSPPESCYTSRESDPTGLDFHSAGRDSLSAGHQFNSLYQELDLDSLHEDLS*SMPGTTTETSASAPESCQTAEAEDLPGAARKELKSVLTKLEEEIVTLRHTLAAKER
RCTELKRKLGLLALVALRQNPSKSWHNVQVSDVYMKQKTPAAVSTMGSAVCRKLGDMKKSATFRSFEGLMGAIKSRVAGGRELARDCLPSSAGSGDDLPASGSRDDPLPL
TQSGNDPIQ*
44 >lcl|XP_538734.3|Plus1complement(44730970..44733003) NW_876253 zinc finger and BTB domain-containing protein 5 ZBTB5 __SEG__ Chr11 {Canis lupus familiaris} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALNASQSGEEQPAPMSSSMRSTLDQRTPFPMRRLHKRKQSAEERARQRLRPTMDESAIADVTPE
NGPSGVHSREEFFSPDSLKIVDNPKGDGMTDNQEDSAIMFDQSFGAQEDAQVPSQSDNTAGNMAQLSMASRATQVETSFEQEAATEKSGFQCENSDVGLGEKEHMRVVVK
SEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGSNFSANQNNDDNIPNTTSDCRL
EGEAPYLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVRPMQEVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMMGSPRGGASNFPYYRRIAPKMPVVTSVRS
SQIPENSASSQLMMNAATSSFENGHPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHS
KTTCLRWQSSNLPSTLL*
45 >lcl|XP_538805.2|Plus1complement(58699566..58700321) NW_876253 haloacid dehalogenase-like hydrolase domain containing 3 HDHD3 __SEG__ Chr11 {Canis lupus familiaris} MGRWLPIRLLTWDVKDTLLRLRHPVGEEYAAKARAHGLEVEAATLGQAFRQAYRTQSHSFPNYGLSQGLTSRRWWLDVVLQTFYLAGVRDAQAVAPIADQLYEDFSKPCT
WQVLEGAAATLRGCRKRGLRLAVVSNFDRRLEDILTGLGLREHFDFVLTSEAAGWPKPDPRIFHEALRLAQVEPAGAAHIGDSYLCDYKGAQGVGMHSFLVFGPEPLDSA
VKCSVPQEHLLPSLSHLLPALDRLEGSALEL*
46 >lcl|XP_538840.2|Plus1complement(1359610..1360989) NW_876254 zinc finger and BTB domain-containing protein 12 ZBTB12 __SEG__ Chr12 {Canis lupus familiaris} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGISDASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVA
HRLKPPGGLGGGLSIGGSVGGHLGELTQSSVPPSTVAPQQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSSGNPL
KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGK
TTAENVLEASVAEINVLIR*
47 >lcl|XP_538961.2|Plus120056361..20057425 NW_876254 membrane progestin receptor beta PAQR8 __SEG__ Chr12 {Canis lupus familiaris} MTTAILERLSTLSVSGQQLRRLPKLLEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWAATRSL
PLLLFILSSLTYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYELFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKLCQVVPAGLA
FVLDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAILLDYQGRQEIFLQRHSPLSVYMACLSFFFL
AACSAATAALLRHKVKARLTKKDS*
48 >lcl|XP_539451.1|Plus131593163..31594113 NW_876258 aldose reductase-like isoform 1 LOC482334 __SEG__ Chr14 {Canis lupus familiaris} MASHLVLCNGAKMPVLGLGTWKSPPGKVTDAVKVAIDLGYRHIDCAHVYQNENEVGLAIQEKLKEQVVKREDLFVVSKLWCTYHEKSMVKGACQKTLSDLKLDYLDLYLI
HWPTGFKAGKEYFPLDGEGNVIPSDTSFVDTWEAMEQLVDEGLVKAIGVSNFNHLQIEKILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQAKGIVVTAYSPLGSPDRPW
AKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFQVFDFELSSVDMTTLLSYNRNWRVCALVSCASHKDYPFTEEF*
49 >lcl|XP_540101.3|Plus115420089..15420679 NW_876263 rho-related GTP-binding protein RhoB RHOB __SEG__ Chr17 {Canis lupus familiaris} MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNV
PIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYEYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL*
50 >lcl|XP_540227.3|Plus149358658..49359362 NW_876263 probable N-acetyltransferase 8B NAT8B __SEG__ Chr17 {Canis lupus familiaris} MAPYHIRKYQERDRPRVLDLFSKGMEEHAPTTFCHVLKLPRTLALLLGVPLALFLASGSWLLVFVASLALLTALRFFSKYPWVQFKVLCLRSDLSDITKSYLGEPGSCFW
VAEAAGQVVGMVGVLPAADCPLRREQLQLFHLCVASECRGQGVAKALLRTVLQFARDQGYSQVVLHTTMLQRSAVALYQRMGFQKTGQFFPSLNWRLFAIPSCVFVYPLP
SAQASQAQGQAGGP*
51 >lcl|XP_541547.1|Plus139996969..39997385 NW_876270 nanos homolog 2 NANOS2 __SEG__ Chr1 {Canis lupus familiaris} MQLPAFDMWKDYFNLSKVVLALIQSGGQRPEAQGNGEPRPGPQLGQDQGVGGPGASRSLATLCNFCKHNGESRHVYSSHQLKTPEGVVVCPILRHYVCPLCGATGGQAHT
LKYCPLNGGQQSLYRRSGRNSAGRKVKR*
52 >lcl|XP_541726.2|Plus1complement(52107319..52108170) NW_876270 pleckstrin homology domain-containing family F member 1 PLEKHF1 __SEG__ Chr1 {Canis lupus familiaris} MVDYLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLSKRKYRGQHIIPLEEVTLEPLPETLQAKNRWMIKTAKKSFV
VSAASTTERQEWISHIEECVRRQLLATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFLLPRLSPKPLRVCSLCYRELAARKREEEE
EGGGPGGGGAPGQPRAYLGGAECGASSGDDEDSDEDKEGGGDGDWPSHVEFYASGVSWSAFHG*
53 >lcl|XP_541869.3|Plus1complement(13003841..13006537) NW_876272 putative RNA-binding protein 15B RBM15B __SEG__ Chr20 {Canis lupus familiaris} MKRQSERDSSPSGRGSSSSAKRPREREREAEAGGRRAAHKASGGAKHPVPTRARDKPRGSGGGGGGHRDGRGAGDANHRASSGRSSGSGAGGGGRGGKASGDPGASGASP
RASPLPPPPPPPGAEPAGPGSSAAAPEYKTLLISSLSPALPAEHLEDRLFHQFKRFGEISLRLSHTPELGRVAYVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLR
GGGGGGGGGGGGGSSRRSSSSSAAASTPPPGPPAPADPLGYLPLHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYPA
VCEEDLMPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSL
AALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEETRYPQQYQPSPLPVHYELLPDGYTRHRSLDADLRVRDRTPPHLLYSD
RDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGDGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGGGPQVDRGSDRTPERSRKENHSSDGTKESSSN
SLSNSRHGAEERSHHHHHEAPDSSHGKKTRESERNHRTAEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVITGLLKDHTSGSKLTQ
LKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQATPSGPGTEGMPTVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDSTGMLYAFPPCDFSQQYLQSALRT
LGKLEEEHMVIVIVRDTA*
54 >lcl|XP_542150.2|Plus1complement(29734809..29736830) NW_876272 protein fem-1 homolog A FEM1A __SEG__ Chr20 {Canis lupus familiaris} MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAARYGHLDVVEYLVDRCGASVEAGGSVHFDGETIEGAPPLWAASAAGHLDVVRSLLRRGASVN
RTTRTNSTPLRAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCNARMERDGYGMTPLL
AASVTGHTNIVEYLIQEQPAGDGVRPGLPREGPSSSSSAAAAPGPAGAQPQGARCCGGPSAAEEPLGDSYESCCPTSREAAVEALELLGATYVDKKRDLLGALKHWRRAM
ELRHQGGAYLPKPEPPQLVLAYDYSREVNTTEELEALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQQSNLEPLSPMTASSFL
SFAELFSYVLQDRAAKGSLGTQIGFPDLMGVLCKGVREVERALQLPKEPGDSAQFTKALAIILHLLYLLEKVECTPDQEHLKHQTVYRLLKCAPRGKNGFTPLHMAVDKD
TTNVGRYPVGRFPSLQVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPGIMNTLIEAGAHMDATNAFKKTAYELLDEKLLAKSTIQPFNYVTLQCLAARALDKNKIPYKG
FIPEELEAFIELH*
55 >lcl|XP_542186.1|Plus131431323..31431919 NW_876272 GTP-binding protein Di-Ras1 DIRAS1 __SEG__ Chr20 {Canis lupus familiaris} MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSKQSLEELGPIYKLIVQIKGS
VEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRASKQKRTDRVKGKCVLM*
56 >lcl|XP_542222.2|Plus132990637..32991908 NW_876272 C2 calcium-dependent domain-containing protein 4C-like C2CD4C __SEG__ Chr20 {Canis lupus familiaris} MRKTNMWFLERLRGSGEHGTPGSEAGDKAAKGPLYSNVLTPDKIPDFFIPPKLPAGPTDAEGQAEPGPAAAAAEQNPASGPPRRAPRSPRLPAKLAAESKNLLKAATRHV
IQIESAEDWPVEEAATNADPQAQGAMSLPSVPKAQTSYGFATLAESPHTRRKESLFHSEHGALAQVGSPGAGRRRGGATKANGGDGVPREAAGALMSPSRYFSGGESDTG
SSAESSPFGSPLLSRSVSLLKGFAQDSQAKVSQLKQSAGRHGSLAAEDGAPDTSPGARRRLTRRAAPEPGPETGQVPRAEHAVRVGPRGSVRLLAEYEAAQARLRVRLLA
AEGLYDCLCDARSINCCVGLCLVPGKLQKQRSTIIKNSRHPVFNEDFFFDGLGPASVRKLALRIKVVNKGSSLKRDTLLGEKELPLTSLLPSL*
57 >lcl|XP_542335.2|Plus1complement(26378523..26379290) NW_876273 rho-related GTP-binding protein RhoG RHOG __SEG__ Chr21 {Canis lupus familiaris} MGLQDGVRLREQELVSVHVFPFFLPVGRVLPNHECPFNLSIGHCIRRVPEGEGGVASTVAAAPTMQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAV
DGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLE
CSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCVLL*
58 >lcl|XP_542573.2|Plus15329612..5330355 NW_876274 seven in absentia homolog 3-like SIAH3 __SEG__ Chr22 {Canis lupus familiaris} MAYLGRLSQAERLASTTNALLFLPQYVSSRRTVTQSAPEQGNFPPHHLTHHHRHHRPHHHLRHHAHPHHLHHQEAGLHATQVTPCMCPLFSCQWEGHLEVVVPHLRQMHR
VDILQGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFTYRLELNRNHRRLKWEATPRSVLECVDSVITDGDCLVLNTSLA
QLFSDNGSLAIGIAITATEVCSSEAEM*
59 >lcl|XP_542575.1|Plus15773885..5774664 NW_876274 BTB/POZ domain-containing protein KCTD4 KCTD4 __SEG__ Chr22 {Canis lupus familiaris} MERKINRREKEKEYEGKHNSLEDADQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLL
AQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFIKSENGTRLVLKEDNTFVCTL
ETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK*
60 >lcl|XP_542586.1|Plus19335646..9337685 NW_876274 kelch repeat and BTB domain-containing protein 7 KBTBD7 __SEG__ Chr22 {Canis lupus familiaris} MQSREEAPRPRRLASPRGGRRPKRISKPSVSAFFTGPEELKDAAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESHQA
NVTMHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLANCTAILKFADAFDHHKLRSQAQSFIAHNFRQLSRMGSVREESLADLSLA
QLLSILRLDSLDIESERTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFREEDQDYLEGLLTKPIVKKYCLDLIEGALQMRYGDKLCKALAPKPDSSSSCVVPTAENPP
QRLGMCAKEMVIFFGHPRDPFLCYDPYSGDIYTMPSPLTSLAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRDP
ITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVNSKRMLYYDPGHNTWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDSE
THNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSDD
EVWVQVAPQGNAQDHQGSL*
61 >lcl|XP_542614.3|Plus1complement(30454169..30455152) NW_876274 BTB/POZ domain-containing protein KCTD12 KCTD12 __SEG__ Chr22 {Canis lupus familiaris} MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPER
SRLQREAEYFELPELVRRLGAPQQPGPGPPPPHSRRGVQKEGSLGDELLPLGCAEPEQQEGSSAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSY
TIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE*
62 >lcl|XP_542795.1|Plus133344351..33345589 NW_876276 transmembrane protein 22 TMEM22 __SEG__ Chr23 {Canis lupus familiaris} MDTSPSKKYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEDYGNFMEENPKKGLLSEMKRKGRTFFGTMDTRPPLTEDPMTNDIGQFQSFAEKNIFQSRKMWIVLFG
SALAHGCVALITRLVSDRSKVPSLELIFIRSVLQVLSVLVVCYYQEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILAFLLVDEKMAY
VDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKEKISMWTALFTFGWTGTIWGISTMFVLQEPIIPLDGETWSYLIAICVCSTA
AFLGVYYALDKFHPALVSTVQHLEIVVAMVLQLLVLHIFPSVYDVFGGVIIMISVFVLAGYKLYWRNLRRQDYQEILDSPIK*
63 >lcl|XP_542820.2|Plus1complement(38602251..38603384) NW_876276 progestin and adipoQ receptor family member 9 PAQR9 __SEG__ Chr23 {Canis lupus familiaris} MARRLQPRGAGTKGPPAATAAASEAGPRPHPSAAAEPLASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGR
DVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYVQQRLGWHVDCTRLIAAYRALVLPVAFVL
AVACTVACCKSRTDWCSYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIHPGLFDIIGHSHQLFHIFTFLSIYDQVYYVE
EGLRQFLEAPPAAPTFSGTVGYMLLLVVCLGLVIKKFLNSAESCSKK*
64 >lcl|XP_543040.3|Plus1complement(35208759..35209310) NW_876277 rho-related GTP-binding protein RhoC-like LOC485916 __SEG__ Chr24 {Canis lupus familiaris} MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVCVPTVFENYVTDIEVDGKQGELALWDTAGQEDYDRLRPLSYPDTDVILMCFSINSPDSLENIPEKWTPEVKHSCPNV
PITAVGNRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRVGLQDSKNKRRRGCAIL*
65 >lcl|XP_543274.3|Plus1complement(21086914..21090633) NW_876279 LOW QUALITY PROTEIN: insulin receptor substrate 1 IRS1 __SEG__ Chr25 {Canis lupus familiaris} MASPPETDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQAL
LQLHNRAKGHHDGASAPGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENF
FFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLTRRSRTESITATSPASMVGGKQGSFRVRASS
DGEGTMSRPASVDGSPVSPSTTRTHAHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGGFISSDEYGSSPCDFRS
SFRSVTPDSLGHTPPARGEEELSNYICMGGKGSSTLTAPNGHYILPRGGNGHRYIPGAGLGTSPALAADEAAAAADLDNRFRKRTHSAGTSPTISHQKTPSQSSVASIEE
YTEMMPAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHPLDRRGGHHRPDAAALHTDDGYMPMSPGVAPVPSSRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGSCSPDIGGGPGSSSSGSAAPSGSSYGKLWTNGVGGHHPHALPHPKLPVESGSGKLLSCTGDYMNMSPVGDSNTSSPSDGYYGPEDPQHKPVLSYYSLPRSF
KHTQRPGELEESARHSTSASPPARVVFSTPRRRKIPPPPPAATAWAQGDTVGSGRIPASRISTIRSCSLTCLGRWTRPRRPTAAWLGPRGCPWGTPRPAPYLGFESSSTR
RPCCTLRSPRAPGNM*ILSSGAISRATYRGRWLPAARLLSGAHPSSSQLPARKRLAPRST*TWTWGLAGGQPGRRVLGSSPAGWAPRPPGPLACAGPPGQCPAAGATT*P
CRWAVPARATWTPRQWPPSATLTCGQALSWRRPACRGPQRPPPPRPRQPRLPPRRLQKRGSWWPAPPCWGARRDPGA*APSPG*TSAPTATRVPK*SAPTRRGAGGGIAL
RPSPPRPVPPGRATQCPSAGGRPWGAAVAAAARRI*NATVRLPLRTCG*GLGSSGEPPRSRPRTLGPPGVWRMGLTT*TWIWSRTSNSALRSAPLNRSRPRPRPLISLWA
AVRAVQPAAPARI*APMPASVSRSSQRTSS
66 >lcl|XP_544177.3|Plus1complement(38618487..38621471) NW_876288 RNA-binding protein 12B RBM12B __SEG__ Chr29 {Canis lupus familiaris} MAVVIRLLGLPFIAGPVDIRHFFTGLTIPDGGVHIIGGEIGEAFIIFATDEDARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMRRTDRIGRERPGSGASGAGSLSNFV
EAIKEEASNSGYGSPINQDAGFHTNGTGHGDLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCVDGVIFLKHHDGRNNGDAIVKFASCIDASGGLKCHRSFMGS
RFIEVMQGSEQQWIEFGGNAVKEVDIPMRTEEHSPPRGINDRHFRKRSHSKSPRRTRSRSPLGFYVHLKNLSLSINKRDLRNFFRDTDLTNEQIRFLYKDERRTRYAFVM
FKTLKDYNSALGLHKTVLQYRPVHIDPVSRKQMLKFIECYEKKRPVSVEKERLGHVSQKYSQEGYPGQKLCIYIRNFPFDVTKVEVQKFFADFSLGEDDIYLLYDDKGVG
LGEALVKFKTEEQAVKAERLNRRRFLGTEVLLRLISEAQMQEFGVSFSLMSTERMQGHSQSCDRDDHAHSFDSSDPPLYSAGPSENFRHQQEDLRQLDSFKQTQADFRQL
DRSLPEDFRHSPEDFRRSPEDFRRPREEHFRRPLEEDFRRPWEEGFRYPREEDFRYPREEDWRRPPEEDFRRPPKDDFRRPPEEDWRRLPEGDFRRPPEEDWRRPPEDDF
RRLPQGEWRRPPEEDFRRPPEEDFRRLPEEDFRRLPEEDFRRPPEEDFRRSPEEDFRRSPEEDFRRPPPEHFRRPPPEHLRRPPPEHFRRPPPEHFRRPPPEHFRRPPQE
HFRRPPQEHFRRPPQEHFRRPREEEFRRPPDEDFRGPPDEDFRQPAEEDFRSPQEEDFRGPSDEDFRRLPEEDPREPPEEDPRLPDPFRPPGEEFRSPPDDFRSHRPFVN
FGRPEGGKFDFGKRSLGSFPEGRFMPDPKLNCSSGRVTPIKIMNLPFKANVNEILDFFHGYRILPDSVSIQYNEQGLPTGEAIVAMINYNEAMAAIKDLNDRPVGPRKVK
LTLL*
67 >lcl|XP_544373.3|Plus1complement(22533950..22535719) NW_876292 ectoderm-neural cortex protein 1 ENC1 __SEG__ Chr2 {Canis lupus familiaris} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
68 >lcl|XP_544490.3|Plus139468217..39469263 NW_876292 LOW QUALITY PROTEIN: membrane progestin receptor alpha PAQR7 __SEG__ Chr2 {Canis lupus familiaris} MATMVAQKLSHLLPTLRQAHQEPQPSGQPEPVFTVDRAEVPPLFWKPYIYVGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLAVFAGTVDFWGDPHALPLF
IIVLASFTYLSLSALAHLLQAKSEFWHYQLLLPGLRGRGRVPVRQRPGALLLRHRARLARPGADHLPAHGRLSRLAFLHRLLLQQV*PETWPAGPHLPGGALRAGLRAGH
QPRGAPHPGVPRPHGR*PSSSLPQVPGGLLPAGCCVLLSLRA*ALVSWQLPRLWPGPPALPRIPGAVHPGSAGGRGPGLRGPAAHL*ASARPLASQLLWPLPAHGGQQCP
DRVPAEPAGAAQTRPEDPV
69 >lcl|XP_544756.2|Plus135660665..35661303 NW_876294 sentrin-specific protease 8 SENP8 __SEG__ Chr30 {Canis lupus familiaris} MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVCFISPEVTQFIKCTSNQTEIAMFLEPLDLPNKRVVFLAINDNSNEAAGGTHWSLLVYIQ
DKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQPESLLQLLTPTYITKKRGEWKDLIARLAKN*
70 >lcl|XP_544900.1|Plus1complement(35705578..35708751) NW_876295 zinc finger protein 295 isoform 1 ZNF295 __SEG__ Chr31 {Canis lupus familiaris} MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLG
ISFLTNIVSKTPQAPFPTCPNRKKIFIEDDESSSQKRSVIVCQSRNEAQGKTVSQNQPDLSHTSRPSPSAAAKTSTSKPHVPKAAEPLHSLPLADKSWPKDGSVGYAKPL
EHSGPLDDPSRSSLVKRSAPPPSKPPQDREPMDEKAGLSSQLPKGKAIELALKRPRPPVLSLGGSTETPYVLKETHRGGGPGEDRNLLYYSKLGLVVPSSGSGSGKPGID
RSGPLVKSLLRRSLSMDSQVPVYSPSIDLKPSPGPPSAASDVPGAVFCAVAQKAPVKDCGEKAAPEERSPAPQPHRLRSFSASQSTEREGEPAVTEVRIKTEPRSPLADP
SDIIRVTVGDPAAATRDLPLKTEDDQKDASRLPAKRRLRTDRRPPLKKVREDEPGSPVSAESFQGGPSPPLPDGEFPDSDLNKDEFGELEGTRPNKKFKCKHCLKIFRST
AGLHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGIVKNPSPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRSKPGFQGQSSSQAQAIKRNLRSRAKGA
YICTYCGKAYRFLSQFKQHIKMHPGEKPIGVHRAAKPKEHVALESPVENKEVYQCRLCNAKLSSLLEQGNHERLCRNATVCPYCSLRFFSPELKQEHESKCEYKKLTCLD
CMRTFKSSFSIWRHQVEVHNQNTMAPAENFSLPVLDHNGDVAAASRPQAQPEPGKANHAVTAKDDTAFSDCSEHVNFDSEDSSCLPEDLSLSKQLKIHVKEEPAEEAEEE
APEARAAPKEAGSSKDSSLWPCEKCGKTFTAHKQLERHQELLCSVKPFICHVCNKAFRTNFRLWSHFQSHMSQATEEPAHKDSEACPAPTNSPSPPPLPPPPPLPKIQPL
EPDSPTGLAEHPAPSTEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQSHN*
71 >lcl|XP_545843.1|Plus1complement(12133202..12134971) NW_876307 ectoderm-neural cortex protein 2 KLHL25 __SEG__ Chr3 {Canis lupus familiaris} MSVSVHETRKSRSSTGSMNITLFHKASHPDCVLAHLNTLRKHRMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
VINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKH
DLEQRKAHLPELLRSVRLALLPSDCLKEAVSGEALLMADERTRLIIDEALRCKTKILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSASAIGCKVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPAANKWTMVAPLRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPS*
72 >lcl|XP_545891.1|Plus1complement(20634316..20635920) NW_876307 ankyrin repeat domain-containing protein 34C-like ANKRD34C __SEG__ Chr3 {Canis lupus familiaris} MDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGETALMVACITKHVDQQSISKSKMVKYLLDQRADPNIQDKSGKTALIHACIRGAGGEVVSLLLENGAD
PSLEDRTGASALVYAINADDKDALKHLLDACKAKGKEVIIITTDKSSSGTKTTKQYLNVPPSPKVEDRQPPPLCMSPSDIELKAPGLGSPPSEREDDFFSLQTGHLSSCN
TAKALNEPGSPTRKAGNPKRARLPQLKRLQSEPWGLIAPSVLAANTRQDETYGASADGEVIKSISDMSFPKRGPLSRTNSIDGKDPTLFPTVTEQVLKIPASPAPASWKA
VYEKGQASHPRLARRGTLPIDQEKAGVSATGSPALKDSVSLKWLENDLHDLDLQAAAEQLSSVSLEPSKGPLDRKRLNGSHLALFHGSRESLDAAPSTSPSSARRRPPHL
LERRGSGTLLLDRISHTRPGFLPPLNVNLNPPIPDIRSSSKPPSPLAGGLKSMVPVAPSSPKRVDLRSKKKLLRRHSMQVEQMKQLSDFEEIMT*
73 >lcl|XP_545951.1|Plus1complement(35025087..35025662) NW_876307 rho-related GTP-binding protein RhoH RHOH __SEG__ Chr3 {Canis lupus familiaris} MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIAEIRSNLPCTP
VLVVATQTDQREVGPHRASCINAIEGKKLAQEVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRFFSINECKIF*
74 >lcl|XP_546044.2|Plus126483835..26485379 NW_876308 ankyrin repeat domain-containing protein 34B ANKRD34B __SEG__ Chr3 {Canis lupus familiaris} MDEGLEISSEGNSLIKAVHQSRLRLTRLLLEGGAYINESNDRGETPLMIACKTKHVDHQSVSKAKMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGAD
LSLQDHSSSSALVYAINSEDRETLKVLLSACKAKGKEVIIITTAKSPCGRHTTKQYLNMPPVDTDGCHSSASCATPSEIDIKTASLPFSHSSETEKTLFGLKGLEPSGKS
DDTQDPGSPMRKPAMASNGAKLPQAPTWIKSPPLLMHQNRVASLQEELQDITPEEELSYKTNGLALSKRFITRHQSIDIKDTAYLLRAFDQASSRKMSYDEINHQLLFSE
GNQQCLEIPADPDPDSNQTMFVSTLRSIVQKRNSGANHYSSDSQLTAGLTPTTLEDGKALLGKKKILSPSPSLLSGPKELLESISPGPLSRRNHALLERRGSGAFPLDHN
STPPRPGFLPPLHVNPHPPISDTSVNNKISSLLSCGQKVLMPTVPMFPKEFKSKKMLLRRQSLQTEQIKQLVNF*
75 >lcl|XP_546614.2|Plus1complement(3431520..3433238) NW_876313 major facilitator superfamily domain-containing protein 6-like MFSD6L __SEG__ Chr5 {Canis lupus familiaris} MSANPQWDISRALGVARLFHLVCGVRDACVTPFLTLYLRQLGLAAPWVGVLMGAKHLVAAFWAPSWAFLAKSYRKRRALLTGSLLGSAGASLLMALVPPPDEAPADPSCN
ASRGARPSALPPAAASIPRAVGAPGLRRAPAGGVHAPAGRPAGYTVGYAVGSVEGAGTAARVLPPVASGLRDTARAGAFKVGRTAPPLLAGGTAPGSPANLSAAKGDAGA
LGLSLEGLRWTFLLSLGSVVFWELLTAPLEQVADDSLYEYLDFVDATDRYGSLWIWRLLGLSAGVCGIAAAVGQLECFVATSGPRGVLHFYGYSVVSTVALLVSIAFPVP
ICRRQEPSYKTIKALSLVGGDPRLILLTFTVFLVGAATSAVQNFLFWHMKDHGSSELVMGFSVALGLLGEILLHPFKTTLLRKLSRMGTVGLGLGCLAAQLLYYSFLWSW
WAALPAQILSAVSNGALWWAVKASVEDLATPRTERPLGAMFRGHIFGGGSSLGSFVGGFVVMYFSLAVLYRACCVLLLLWLALLLSIQSRLPQEQKINYSKLLVMEASDT
SDSEQGTERDWLVKAMREEYSE*
76 >lcl|XP_547188.1|Plus1complement(21379731..21380396) NW_876321 fumarylacetoacetate hydrolase domain-containing protein 1 FAHD1 __SEG__ Chr6 {Canis lupus familiaris} MAVHRPLSRFWEWGKNIVCVGRNYADHAREMRSEVPAEPVLFLKPSTAYAPEGSAILMPAYTRNLHHELELGVVMGRRGRAVPEAAAMDYVAGYALCLDMTARDVQDECK
KKGLPWTLAKSFTTSCPVSAFVPKEKVPDPHNLKLWLKVNGELRQEGDTSSMIFSIPYIISYVSKIMTLEEGDIILTGTPKGVGPVKENDEIQAGIHGVVSMRFQVQGPR
C*
77 >lcl|XP_548046.2|Plus1complement(745809..747791) NW_876331 signal peptide peptidase-like 2C-like LOC490923 __SEG__ Chr9 {Canis lupus familiaris} MACLGFLLLLLTSTTARRQYGVVHVVSENWSKDYCVLFSSDHVTLPRDLHHAPLLPLHDGTAAPWCPGKDSPARARPLRQATAMVMRGNCSLHAKGWLAQGRGAHGLLIV
SRLGGRQCSDSSPGPQERRAPRPGLTIPVAELRHADLLDILSHTHGSASVRAALYAPPEPGLDCNVVVLFLLAVGTVAAGGYWAGLSEAERLRRGARGAGGGAAAPGEAA
AAEGAEDASVDFTPAVAGAVVTMSCSIMLLLYFFYDGFVYVLIATFGLGAGTGLYSCLAPLARRLPLQLSPRPPAGPRACPRLPLLLLAGLCAAVTAAWVAHRNEDRWAW
LLQDALGVAYCLFVLRRVRLPTLKNCASFLLALLAFDVFFVFITPLLTRTGESIMVEVASGPVDSSSHERLPMVLRVPRLSFSALTLCDQPFSILGFGDIVVPGFLVAYC
HRFDVQIQSHQVYFVACTAAYAVGLLVTFVAMVLMQMGQPALLYLVSSTLLTSLAVAACRQELTLFWTGQARAKTPAQPVAGLHDAPSFGSEQKQEETADVHTAGKFEGA
TGHLAGDLDSNLEEAEAEATTASEDEASGLDVHSDSSEGWRDANLDPDELPQASPGSSEELVPLMPPPSVLGQARAQAQAQAHDTGLPWMGLHKRKGGKVQRSMSTHAPL
*
78 >lcl|XP_548350.1|Plus1complement(632857..634131) NW_876333 torsin family protein C9orf167-like LOC491229 __SEG__ Chr9 {Canis lupus familiaris} MDGGQPGLEPAAPGPSIPGPSVIAPLRAVVRLRRRVCLLRKRRLLPPGAGPALGPGAPRPGCSSGAPPADPDRPQFFTFDGPAELPSRTPRKRRRRSRVVLYPETSRKCR
PHAERRSRAQRCLLLLVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRAVFGQPEAVARIVALLRDYLATHVHSRPLLLALHGPSGVGKSHVGRLLARHFRSVLEDGAL
VLQYHARHHCPEARAAQACREELAALVADVVARAEVEEKTPLVVLDEAELMPPALLDELHGFLQPQRAHPFHNAIYVLLSGVGGAEITRFVLQNAASAGPQRPDAHLEPA
LAAAVQTDEELRARLRVLLVREHPLWQAAAIVPFLLLDKQDVVSCFRDEMAGEGFFPEQARAELLAAQLSYYRVAGREFSVTGCKQVVARVNLL*
79 >lcl|XP_548452.3|Plus1complement(8640209..8641723) NW_876333 zinc finger and BTB domain-containing protein 34 ZBTB34 __SEG__ Chr9 {Canis lupus familiaris} MSVEMDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLSISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAA
SFLQMQCVIDKCTQILESIHSKISVGDVDSVTVGAEEATESRNGVKDSSFFANPVEISPPYCSQGRQPTTSSDLRMETTPSKALRSRLQEEGHSDRGSSGSVSEYEIQIE
GDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAASQPTGVSEAFGSLSNSSPSRSMLSCFRGGRARQKRAL
SVHLHSDLQGLVQGSDSEAMMNNPGYESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIRGHTDDKPFRCEICGKC
FPFQGTLNQHLRKNHPGVAEVRSRIESPERTDVYMEQKLENDASASEMALDSRMEIHTVSDAPD*
80 >lcl|XP_548889.3|Plus1complement(17321578..17323533) NW_879562 kelch-like protein 34 KLHL34 __SEG__ ChrX {Canis lupus familiaris} MSYFLSYCKAHGGALLTGYQALRAEGFLCDVTLEAEGSEFPAHRSLLACASDYFRALFKSHTRESRASVIHLHVPSAAGLQRLLDFIYTAWLPLSMDTVEDTLEAASYLQ
VTEALGLCGRYLERQLAPDNCCFAANVAARFGLLHTLGAAERCIARHLRELLLRGAGPAGLLELNPTSLKALLGAPDLARVPESWLLGLALAWLRQEPEAERLAHCASLL
ERVRFGLVPADVLRRVYSGSGLDLPARVKGLIIQALNYHRAPSRQPLLQGEQTSVRSPQTRILLVGGRRAREAVAEEVVVPQRVARGRGAAPEPQEEEEEEEEEEEQVEE
EEDWELTQDVLAFDVYNHRWRSLTRLPAPLLGHSVCTAGNFLFVLGGESPPEAASSPPADGPRPVTAEVHRYDPRFHAWTALPAMREARAHFWCGAVGEGLLAVGGLGAD
GQALASVEMYDLRRDRWTAAAALPRALHGHAGAVGDRGVVYISGGKAGSGEGGASSLRDVYALGPGERAWSKRAPMSTARFGHHMAVLRGAVFAFLGRYEPFSEIERYDP
GTDQWTRLRPLPYDRFCYGLAVVEETALLLGGLKWRESRQVPTRNVVGYDLDLDRWEDIGCALPWAWSGLQCAVLQLAEGGDEEREGGRAGAPDLVLGLMG*
81 >lcl|XP_548937.2|Plus1complement(31526587..31527675) NW_879562 poly(rC)-binding protein 1-like LOC491817 __SEG__ ChrX {Canis lupus familiaris} MDARVTESELNATLTIRLLMHRKEVGSIIGKKGESPKRFRKESGARINISEGNCPERIITLTGPTNAIFKAFVMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPAYQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRWGYAAGYPHAAGYPHDTHYL
EGPPLDAYSIQGQHTVSPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSNSPEVKGYWASLDASTQTTHEFTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSG
RQVTITGSAASISLAQYLINARLSSEKGMGCS*
82 >lcl|XP_548988.1|Plus141883088..41883789 NW_879562 GTPase ERas ERAS __SEG__ ChrX {Canis lupus familiaris} MALPRKPNMFDLGLGTWSLSSREENQRAQAPSKSVRKQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKEVALGHGGCILNVLDTAGQATHRALRDQCV
AIGDGVLGVFALDDPSSLAQLQQMRATWGPRHTQPLVLVGNKCDLVTTTGDAHAAAAALAKSWGAPFVETSAKTRQGVEEAFTLLIHEIQKVREAMAKEAMAGASGDKSR
HQKAMCRCGCSVA*
83 >lcl|XP_549029.2|Plus147800360..47802231 NW_879562 ubiquilin-2 isoform 1 UBQLN2 __SEG__ ChrX {Canis lupus familiaris} MAENGESSGPPRPSRGPAAAQGPASAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQG
QSTQPSNAAGTNTTSASTPRSNSTSVSTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQNQMQQQLLSSPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPE
ISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSTSGEGTQPSRTENRDPLPNPWAPPPATQSSA
TTSTTSSSGSGSGSSSSSATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPVFTANPQLQEQMRPQLPAFLQQMQNP
DTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAGPGSTGSGGPPGPTVSSSTPTETTSPTS
ESGPNQQFIQQMVQALAGASPPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS*
84 >lcl|XP_549032.3|Plus148143928..48146333 NW_879562 zinc finger X-linked protein ZXDB ZXDB __SEG__ ChrX {Canis lupus familiaris} MESPRLLPPRGTRQSGGAGSPAGGSRFHGGPDPRAGQVPARRLLLLRGPQDGGSGRRREEARAASRGPGLSPLAPRSDYASGGDSDDFFLVLLDPVGGDVETAGDGQAAG
PVWREEAESVPQLQQGESGANPAGRQALGPRCLSAVPAPAPAQNPIPAPSLAPAAAFTGTVTIHNQNLLLRFENGVLTLATPPPPAWEPEVAPAPQPGGLMAPQAGVQPN
DCPELPPDLLLAEPAEPAPAPAPEEEAEGRAAAESPRRPLGPGPGVVLYLCPEAQCGQTFAKKHQLKVHLLTHSSSQGQRPFKCPLGGCGWTFTTSYKLKRHLQSHDKLR
PFGCPAEGCGKSFTTVYNLKAHMKGHEQENSFKCEVCEESFPTQAKLSAHQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLK
IHLRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKHEDDRRFMCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVEGCCARFSARSSLYIHSKKHLQDVDTWKSRCPVS
TCNKLFTSKHSMKTHLAKRHNLGQDLLAQLEAANSLTPSSELTSQGQNDLSDAELVSLSSDVPGSSSAAVLDTALANSGILTIDVASVSSTLAGSLPANNNNSLGQAVDP
RALMATSDLPQSLDTSLFFGTTASGFQQSPLDMDDVSNLSVGPLVSLGSLAMKNSSQEPQALTPSSKLTVDTDALTPSSTLCENSVSELLTPTKAEWNVHPDSDFFGQEE
ETQFGFSSPAGNHGSQKETDLITVTGSSFLV*
85 >lcl|XP_549069.2|Plus16943603..6944178 NW_879563 rho-related GTP-binding protein RhoG-like LOC491949 __SEG__ ChrX {Canis lupus familiaris} MQTIKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQTSVDGQIVSLNLWDTAGQEEYDRLRTLSYPQTNIFVICFSIGNPSSYANVRHKWHPEVSHHCPNVPV
LLVGTKRDLRNDVETVKKLKEQSLVPTTPQQGTSLAKQVGAVKYLECSALLQDGVHEVFSEAVRAVLYPATKKSTKKCVLL*
86 >lcl|XP_549159.1|Plus1complement(28844609..28845529) NW_879563 mitochondrial carrier triple repeat protein 6 MCART6 __SEG__ ChrX {Canis lupus familiaris} MEEQNHSSGKELQHRTRTESPGKKTWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAVAVSEAVRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCSLSPVG
PHSLGHRWAAGLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWPVLLRNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSV
NGTITCLVLYPLIVLVANMQSHIGWQSMPSLWASAQDVWDTRGRKVFLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSRSRKELKD*
87 >lcl|XP_848992.2|Plus1complement(1133501..1135636) NW_876250 LOW QUALITY PROTEIN: zinc finger and BTB domain-containing protein 39 ZBTB39 __SEG__ Chr10 {Canis lupus familiaris} MGMRIKLQSTNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFLNTGLDAARTYVVDFITPANFEKILSFVYTSELFTDLINVGVIYEVAERLG
MEDLLRACHSTFPDLESTAVAKPLSGTGESHPGTQSCSSAEPAYPLGDLRGAGEHFGPDRNYVLPSDGGGSCKEEERNVTGDINQSLPLPQQPLPPKTEEHDAPAPSPRS
WCGDYPAGPGHCQHEHPNQHELLPAIQSSEQRRLQ*KQFLHPGQRDRHYHRDQLLSEQ*RPLQRPQLRSDG*APAGRPGG**LAV*RPH*GDRHSRGGD*VE**Q*G*AD
FWRE*QPRE*GHALPGVQESSRAQHSADPTACSGPRGPADRQLQGLRDPLPGPELPGDPCSVPHWHFPLLLRHV*N*VLYPVAADPPPTGWDI*EQHHRPPQRSPVWEAG
FVFGGGLGRVEMCCLWEGAGQRFPRGAGARP*PSEPEGPGLQRLRPAPPQPLQPHVAHAVPSGHLSLLLLCVCKQLCGLASPREAHGRASKPRRRPLPLPLVQPELQVGG
CLSLPSQPAQMQQWP*RAARFGATAPSFPEAEAASRGVLE*GAGSAGPAWEQQV*LQGLWQKVCPHKRVQLPPADPHGREAVPV*GVPQVLPRPLDHQVPPEDTLRGPHV
PLHCLWPLQLHPEPHEQACGRAQGQPPARLHHRADLHVHYPFQRGGKEPGQL
88 >lcl|XP_849332.1|Plus14421741..4422316 NW_876310 cell division control protein 42 homolog CDC42 __SEG__ Chr4 {Canis lupus familiaris} MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPAVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPF
LLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL*
89 >lcl|XP_849344.1|Plus1complement(7332099..7332680) NW_876285 cell division control protein 42 homolog isoform 2 LOC607429 __SEG__ Chr28 {Canis lupus familiaris} MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYMPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSYENVKEKWVPEITHHCQKPKT
PFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVKCSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL*
90 >lcl|XP_849645.2|Plus12272581..2273279 NW_876313 BTB/POZ domain-containing protein KCTD11 KCTD11 __SEG__ Chr5 {Canis lupus familiaris} MLGAMFRAGTPIPPNLSPQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIQPLLDALRDLEASRGTPVPTAALLHADVDASPRLVHFSARRGPH
HYELSSVQVDTFRANIFCTDPECLGAMRARFGVASEDRAEGGPHFRLEWAPCPAELPEVEYRRLGLQPLWTGGPGELREVVGTPGFLEEVLRVALEHSFRLDSVFPDPED
LLNSRSLRFVRH*
91 >lcl|XP_849841.2|Plus1complement(2755919..2757841) NW_876254 zinc finger and BTB domain containing 22 ZBTB22 __SEG__ Chr12 {Canis lupus familiaris} MEPSPLSPSGAALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRASATTTTITPAAATSDTVPGAGVPSGSGATVVPATVGSVRSHASIRASENQSPSSSNYFSPRESTDFSS
SSQEAFPASAVGSGERRGGGPVFPAPVVGSGGATSGKLLLEADELCHDGGDERGPVVPGAGLRRPTYAPPSIMPQKHWVYVKRGGNSPAPAPLVPQDPDLEEDEEEDLVL
TCEDDEDEELGGGSRVPEAGGREATLSISDVRTLTEPPDKGEEQVNFCESSNDFGSYDGGGPGAGLDDSGGPTPSSYAPSHPPRPLLPLDMQGNQILVFPSSSSSSSSSS
SSQAPGQPPGNQAEHGAVTLGGTSSGALGMPGGPGGTPGGTGSGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVC
AKKFMWRDSFMRHRGHCERRHRLVGGGGGGGPGPGGPTGPTLPLKRESPGAGGGSGDEASGATPQSSRRVWSPPSVHKVEMGFGGGGGTN*
92 >lcl|XP_850408.2|Plus1complement(3620937..3621626) NW_876297 N-alpha-acetyltransferase 11, NatA catalytic subunit NAA11 __SEG__ Chr32 {Canis lupus familiaris} MNIRNARPDDLVNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKVVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLH
VRKSNRAALHLYSNTLRFQVSEVEPKYYADGEDAYAMKRDLSQMADELRRQLELKKCGGVVLGSRGNQETQGNTLPSSQEDGREENPAADSSGSDSKEPSESTEGTDVQN
SSEDSDSTS*
93 >lcl|XP_850484.2|Plus1complement(7455163..7456311) NW_876294 ankyrin repeat domain-containing protein 63-like LOC608375 __SEG__ Chr30 {Canis lupus familiaris} MLKPKDLCPRAGTRTFLEAMQAGKVHLARFVLDALDRSIIDCRAEQGRTPLMVAVGLPDPALRSRFVRLLLEQGAAVNLRDERGRTALSLACERGHLDAVQLLVQFSGDP
EAADSAGNSPVMWAAACGHGAVLEFLVRSFRRLGLRLDRTNRAGLTALQLAAARGHGTCVQALTGPWGRAAAAAAARGSNSDSPPGRPAPAPSPERRRPSPRRLPRPLLA
RFARAAGGHGHGGDAGSGGKGSGRHRAQGSERPELGRSMSLALGAVTEEEAARLRAGALMARPHSPQSSGTGRWRSQEVLEGAPPTLVQAPIGLSPHPEGGPGSGRLGLR
RRSTAPDIPSLVGEASGPESGPESEANALPHSVPGPQPWQAGTEAVVLHAQR*
94 >lcl|XP_851103.1|Plus120677305..20678087 NW_876273 BTB/POZ domain-containing protein KCTD21 KCTD21 __SEG__ Chr21 {Canis lupus familiaris} MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNA
MLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSF
QVFVEEVLKIALSDGFCIDSSHPHAVDFMNNKIIRLIRYR*
95 >lcl|XP_851529.2|Plus1complement(7926560..7927141) NW_876259 high mobility group protein B4 HMGB4 __SEG__ Chr15 {Canis lupus familiaris} MNMGKEIQLRPKVNVSSYIHFLLNYRNKFKEQQPNTYLGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKKKKRRKRDPQAPRRPPSSFLIFCQDHY
AQLKRENPTWSVVQVAKASGRMWSVTSGAEKQPYEQRAAVLRARYQEELEVYRQQRNTRKGLQGSPKNERRGKADPDRADGSN*
96 >lcl|XP_851640.2|Plus1complement(8682817..8684220) NW_876333 zinc finger and BTB domain-containing protein 43 ZBTB43 __SEG__ Chr9 {Canis lupus familiaris} MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFL
QMWHVVDKCTEVLEGNPTVLCQKLNHGSDHQSPSSSSYNGLVESFELGSGGHADFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGAS
DSAEFHYTRPMYSKPSIMAHKRWIHVKPERFEQACEGMDVHAPYDEHQVTESINTMQTEHSVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERS
DGNLIGHRQEAALASGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWR
DSFHRHVTSCTKSYEAAKAEQNTTEAN*
97 >lcl|XP_851753.1|Plus122580610..22581929 NW_876255 tRNA wybutosine-synthesizing protein 2 homolog TRMT12 __SEG__ Chr13 {Canis lupus familiaris} MEGEAGKPAAVVAVVTEPRFTQRYREYLEKQQLLDRQHRLEKMPDGTVALPVLGEALPERHLQELRNRVAPGSTCRVTQLRDPVPSKKAQGGSPAQRLRLEVSRWVEGRG
VTWSADLEADLPRSWQRHGNLLLLSEDCFQAKQWENLEPELWKTVASALGVHRVAKRGRVSPDGTRTPAVTLLLGDDGWVEHVDNGIRYKFDVTRCMFSFGNITEKLRVA
SLPCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRKNLDINGVAHRCQIHFGDNRKLKLSNIADRVNLGLIPSSEEGWPIACQLLRRDAGGILHIHQNV
ESYPGKTLQPPGSSEMEKEHSSYPQQIVTNQWTNGATRDSRRKMPSAATKPEWQRWAESAETCIATLLQQVHGKPWKTQILHIQPVKSYAPHVDHIVLDLECRPCALHG*
98 >lcl|XP_852083.1|Plus126824417..26825796 NW_879563 armadillo repeat-containing X-linked protein 1 ARMCX1 __SEG__ ChrX {Canis lupus familiaris} MGRTREAGCVAAGVVIGAGACYCVYRLTWGRDESEKIWDGDDEEDEEEEESIDIVESGVKTGKGAKANAGMGTGARLQGEAKVKAEVGMELQSGSDIKAAAQVGAQSGGG
LEAKAKALFNTLKEQASAKAGRGARLSTISGNRTLAPSLPCPGGRGGGCHPTRSSRVGSRASGKTKGRTRGKSTRTPATAWPVRRGKFNFPYKIDDILGAPDLQKVLNIL
ERSNDPFIQEIALVTLGNNAAYSFNQNAIRELGGLPIIAKLIKTKDPIIREKAYNALNNLSVNAENQGKIKTYISQVCDDTMICRLDSAVQMAGLRLLTNMTVTNHYQHL
LSYSFPDFFALLFLGNYFTKIQIMKLIINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKNEGLASSKKEFSRSSLFFLFKESGVCVKKIKAL
ANHNDLVVKVKVLKVLTKL*
99 >lcl|XP_852359.1|Plus1complement(30031438..30032064) NW_876285 coiled-coil domain-containing protein 25-like LOC609428 __SEG__ Chr28 {Canis lupus familiaris} MVFYFTSSSVNSSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGEKIEDIPKEVLMDCAHLVKANSIQGCKMNNVNVVYTPWANLKKTADMDVGQIG
FNRQKDVKIVTVEKKVNEILNRLEKTKMERFPDLAAEKECRDREERNEKKAQIQEMKRREKEEMKKKREMDELRSYSSLMKAENMSSNQDGNDSDEFM*
100 >lcl|XP_852842.2|Plus121094021..21095013 NW_876313 tumor-associated calcium signal transducer 2 TACSTD2 __SEG__ Chr5 {Canis lupus familiaris} MARGRGLALPSPPPPPPLLLLLPPLLLLLAAATRPAAAQGNCTCATNKMTLCRADGPGGRCRCHLPGSDAPLDCSTLTSKCLLLKARARAKSGRALVRPGEHALLDNDGL
YDPDCDRDGRFKARQCNQTSVCWCVNSVGVRRTDKGDRSLRCDELVRTHHILLDLRHRPAARAFNRSELDAELRRLFRERYLLRPRFVAAVHYERPTIQIELRQNASDKA
PGDVDIADAAYYFERDVKGESLFPGRGGLDLRVRGEPLQVERTLIYYLDEKPPQFSMKRLTAGLVAVIVVVVVALVAGVAVLVITNRRKAGKYRKVEVKELGELRNEPSL
*
101 >lcl|XP_853341.2|Plus1complement(172306..173448) NW_876257 BTB/POZ domain-containing protein KCTD8-like LOC610705 __SEG__ Chr13 {Canis lupus familiaris} MALQDPGEGGGGGGAVLPISEMLAAPAAPGPRAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLACMFAPASPRVGARRRAELPRDSRARFFIDRDGFLFRYVLDYLRD
KQLALPEHFPEKERLLREAEYFQLADLVKLLAPKVTRRGSLHDEGCQSDLEDSGSQGSGDALLQRGAAGAPSGGGGGGPGPGPAGAGAGAGAAGGRRSGFLTLGYRGSSA
AARELQADARFRRVARILVCGRIALAKEVFGDTLNESRDPDRPPEKYTSRFYLKFTHLEQAFDRLSEAGFHMVACNSSGSAAAASQYRDDKVWSSYTEYIFFREFPAPPT
CGGSAPHPRAGVLGGGGALRARAGVPKGQVSRAGAGSLPGMRGLESWLEP*
102 >lcl|XP_853772.2|Plus1complement(33105556..33106131) NW_876294 cell division control protein 42 homolog LOC611052 __SEG__ Chr30 {Canis lupus familiaris} MQTTECIVVGDGAIGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPHTLGLSDTAGQEDYDRLQLLSYPQTDVFRVCFSVFSPSSFENVKEKWVPEITHHCPKTPF
LLVRTQIDLRDDPSTIEKPAKNKQKPITPETAEKLACDLKAVKYVECSALTEKGLKNVFDEGILAALEPPEPKKSRRCVLL*
103 >lcl|XP_854638.1|Plus147556347..47556793 NW_876276 ras-related protein Rap-2a RAP2B __SEG__ Chr23 {Canis lupus familiaris} MEDFYRKEIEEDLSRSVLEILDTAGTEQLESMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMET
SAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL*
104 >lcl|XP_855441.2|Plus1complement(60258117..60258692) NW_876253 rRNA-processing protein FCF1 homolog LOC612615 __SEG__ Chr11 {Canis lupus familiaris} MGKQKKARKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKY
RVALRIAKDPRFERLPCTHKGTYAGDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGAPIMYISNHRYNIERMPDDYGAPRF*
105 >lcl|XP_858935.1|Plus1complement(11776109..11778076) NW_876277 RNA-binding protein EWS-like isoform 3 LOC607391 __SEG__ Chr24 {Canis lupus familiaris} MASMDYSIYSQAAAQQGYSVYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSCTQAQTTATYGQTAYATSYGQPPAGYTTPTAPQAYSQPVQGYRTGAYDTTTATVTTTQA
SYAAQSAYGTQPAYPAYGQQPAATAPARPQDGNKPAETSQPQSSTGGYNQPSLGYGHSNYSYPQVPGSYPMQPVTVPPSYPPTGYSSTQPSSYDQSSYSQQNTYGQPSSY
GQQSSYGQQSSYGQQPPTSYPPQTGSYSQDPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENQSMSGPDNQGRGRGGFDRGGMSRGGRGGGRGGMGAGEQG
GFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDNVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKVK
VSLARKKPPMNSMRGGMPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGSGGDRGGFPPRGPRGSRGNPSGEGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGF
LPPPFPPPGGDRGRGGPSGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFCGGRGMDRGGFGGGKRGGPCGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDQPC*
106 >lcl|XP_859505.2|Plus114464217..14466187 NW_876303 RNA-binding protein EWS-like isoform 5 LOC488393 __SEG__ Chr36 {Canis lupus familiaris} MVSTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPAGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQA
SYAAQSAYGTQPAYPAYGQQPAATAPARPQDGNKPAETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSPQPTSYDQSSYSQQNTYGQPSSY
GQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQNSFRQDHPSSMGVYGQESGGFSGPGENQSMSGPDNLGRGRGGFDRGGMSRGGRGGGRGGMGSAGER
GGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDNVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKL
KVSLARKKPPMNSMRGGMPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHGAGDWQCPNPGCGNQNLAWRTECNQCKAPKPEG
FLPPPFPPPGGDRGRGGPGGLRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGREAPGKMDKGEHRQERRDRPY*
107 >lcl|XP_860831.1|Plus1complement(17472224..17474176) NW_879563 RNA-binding protein EWS-like isoform 3 LOC480971 __SEG__ ChrX {Canis lupus familiaris} MASTDYSTYSQAAAQQGYSGYTAQPTQGYAQTTQAYGHQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPAGYTTPTAPQAYIQPVQGYGAGAYDTTTAMVTTTQA
SYAAQSTYGTQPAYPAYGQQPAATAPARPQEGNKPAETSQPQSSIGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSY
GQQSSYGQQSSYGQQPPTSYPPQTGYYSQAPSQYSQQSSSYGQQSSFQQDHPSKMGVYGQESGGFSGPGENQSMSGTDNRGRGRGGFDHAGMSRGGRGGGRGGMGSAGER
GGFNKPGGPMDEGPDLDLGPPVDPDEDSDNNAIYVQGLNDNVTLDDVADLFKQCGIVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKL
KVSLAQKKPPMNSMRGGMPPRESRGMPPPLRGGPGAPWVAWKAVGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPF
LPPGGDRGRGGPGGMQGGRGGLMDCSGPGGMFRGGRSGDRGGFRAGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGHGKMDKGEHRQECRDRPY*
108 >lcl|XP_861182.2|Plus124461734..24463128 NW_879563 heterogeneous nuclear ribonucleoprotein K isoform 7 HNRNPK __SEG__ ChrX {Canis lupus familiaris} METEQPEETFPNTETNGEFGKCPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALHTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEE
GLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHPTDRVVLIGGKPDRVVECIKIILDLISESPIKG
RAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDKMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPG
DRYDGMVGFSADETWDSAIDTWSPSEWQMVYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTISKDLAGSIIGKGGRRIKQVRHESGASIKIDEPLEGSEDRVITITGT
QDQIQNAPYLLQNSVKQYANVEGF*
109 >lcl|XP_865906.1|Plus1complement(23965574..23968447) NW_876321 putative RNA-binding protein 15 isoform 3 RBM15 __SEG__ Chr6 {Canis lupus familiaris} MRAAGREPLPRRSPRWRRAVPLCETSAGRRAQHLRGDDLRRPATMKGKERSPVKPKRSRGGEDSTSRGERSKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSR
EYDTGGGSSSGRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPGVGDGAEYKTLKISELGSQLSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFV
NFRRPEDARAAKHARGRLVLYDRPLKIEAVYVSRRRSRSPLDKDPYPPSAGVVGASVGGHRHPPGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRELERER
DYPFYERVRPAYSLEPRVGAGAGAAPFREVDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIR
NPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQPLPLTHYELVTD
AFGHRAPDPLRGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRTAAAAVPAYEPLDSLDRRRDGWSLDRDRGERDLPSSRDQPRKRRPPEESGGRHLDRSPESDR
PRKRHCAPSPDRSPELSSSRDRYNSDNDRSSRLLILERPSPVRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQ
DGGTAPTTAASPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSATSDT
ATSTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGAS*