SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau R    

ID / Description / Sequence
1 >lcl|NP_001014896.1|Plus1complement(543259..544014) NW_001495496 haloacid dehalogenase-like hydrolase domain-containing protein 3 HDHD3 __SEG__ Chr8 {Bos taurus} MAHRLQLRLLTWDVKDTLLRLRHPVGVEYATKARAHGLEVEATALGQAFKQAYKAQSQSFPNYGLGHGLTSHQWWLDLVQQTFHQAGVRDAQAVAPIAEQLYKDFSSPST
WQVLEGAEATLRGCRKRGLKLAVVSNFDRRLEDILEGVGLREHFDFVLTSEAAGWPKPDPRIFHEALHLAQVEPAVGAHIGDSYQRDYKGARAVGMHSFLVAGPEPLDPA
VKDSVPQEHFLPSLSHLLPALDYLEGSSARL*
2 >lcl|NP_001015565.1|Plus15395643..5396713 NW_001492959 poly(rC)-binding protein 1 PCBP1 __SEG__ Chr11 {Bos taurus} MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLD
AYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT
GSAASISLAQYLINARLSSEKGMGCS*
3 >lcl|NP_001015629.1|Plus1890665..891822 NW_001494026 hypothetical protein LOC522909 LOC522909 __SEG__ Chr21 {Bos taurus} MAIPHASNETSYLLPPNKEDWEGQGIPDFVYEQEELMMEGVQWPRGALSLLNTPPLSHFDSALCSAWRQRMELGLFRYPLGELPTQTLPGTVGFVAQLNVERGVQRRCPQ
NIKSVRQEFDPEQFNFNQIRPGEVLFRLHRKQDCSGTVQQEDILVVINVSPLEWGHVLLVPEPARGLPQRLLPGALRAGVEAVLLSSHPGFRVGFNSLGGLASVNHLHLH
GYYLAHRLPVEGAPSEPLDPRGRLHVLQALPAPGFLFYTSRPGPDLEALISRVCRATDYLTDCEIAHNLFVTRGAPPGKATSSSALSGVRVILWPRKPSFGIKEGEAFNV
ALCELAGHLPVKTAQDFSSLTEAAALALIRECLLPPAQAEDVRAALVALIAREEE*
4 >lcl|NP_001019674.1|Plus1649359..650855 NW_001492996 zinc finger and BTB domain containing 43 ZBTB43 __SEG__ Chr11 {Bos taurus} MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFL
QMWHVVDKCTEVLEGNPTVLCQKLNHGSDHQSPSSSNYNGLVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGAS
DSAEFHYTRPMYSKPSIMAHKRWIHVKPERFEQACEGMDVHAPYDEHQVTESINTVQTEYSVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERS
DGNLIWHKQEAALASGYSENIEMVTGIKEEASHLGFSATDKLYLCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWR
DSFHRHVTSCTKSYEAAKAEQNTTEACTKSYEAAKAEQNTTETCTKSYEAAKAEQNTT*
5 >lcl|NP_001019723.1|Plus1complement(30555..31871) NW_001493200 tRNA wybutosine-synthesizing protein 2 homolog TRMT12 __SEG__ Chr14 {Bos taurus} MEGAGGKPTAVVAVVTEPRFTQRYREYLEKHKLLDRQHRVKKLRDGTVALPVLREALLEQHLRELRNRVAPGSTCVPTQLLDPVPSKKAQSYSPAQRLCLEVSRWVEGRG
VTWSAELEADLPRSWQRHGDLLLLSEDCFQAKQWRHLEPELWETVASALGAQRLAKRGRVSPDSTRTPAVSLLLGDHGWVEHVDNGIRYKFDVTQCMFSFGNITEKLRVA
SLPCAGEVLVDLYAGIGYFTLPFLVHAEAAFVHACEWNPHAVVALRNNLELNGVADRCQIHFGDNRKLKLSNVADRVNLGLIPSSEEGWPVACRVLKQDAGGILHIHQNV
ESFPGKTLQPPGSSEMEEHWPSPHQIISNQLNNGATSDSRRKTLSVATKPEWQRWAKAAETRIATLLHQVHGKRWKTQILHIQPVKSYAPHVDHIVLDLECRPCHLVG*
6 >lcl|NP_001029387.1|Plus1643395..644096 NW_001494798 DIRAS family, GTP-binding RAS-like 3 DIRAS3 __SEG__ Chr3 {Bos taurus} MGNSCFGLKERLMKRLRPLPTVIVIRTCLPQRRSRDFRVVVLGSAGVGKSALVQRWVRGNFREAYLPTIEDTYRQALGCSHKAGALHITDTTGGRRYRGLQRLAIARGHA
FILVYSITRKQTLEELKPLYELIRQLKGNNPQKCPVILVGNKCDESRREVSEKEGAAYACEWNCAFLETSAKMNINVQELFQLLINFEKKPAAAAAPAGAQPPQKKSQIP
KTAEKLLGKCIVM*
7 >lcl|NP_001029830.1|Plus1complement(1701199..1702359) NW_001492860 WD repeat-containing protein 89 WDR89 __SEG__ Chr10 {Bos taurus} MEKIEEQFANLNIVKRSSETKEPTYLLGIDTSKTVQTEKGSLVAVLCSNGSIRIHDKERLNVIREFRGYPGLNGVKFANSHDSVYSSCTDGTVKCWDARLASGKPVQLFK
GYPSNIFISFDISSNDHVICAGTEKVDDDALLVFWDARINSQDLSTTKEPLGAYSETHSDDITQVRFHPSNPNMVVSGSTDGLVNVFDISADNEDDALVTTCNSVSSVSF
IGWSGKDYKQIYCMTHDEGFCWWDLNHLDTDEPITCLNVPDVREVINVKEGILDYLIGGLYHEKTDKLFVVGGTNTGIIRIMNCMTSGLVHVTSLQGGHAATVRSFCWNM
QDDSLLTGGEDAQLLLWKPGAVEKTFTKKDSMKIASSVHQRVRVHSNDSYKRRKKQ*
8 >lcl|NP_001030498.2|Plus11658926..1659624 NW_001493664 BTB/POZ domain-containing protein KCTD11 KCTD11 __SEG__ Chr19 {Bos taurus} MLGAMFRAGTPMTPNLNPEGGGHYFIDRDGKAFRHILNFLRLGRLDLPLGYGETALLRAEADFYQIRPLLDALRELEASRGTPAPTAALLHADVDSSPRLVHFSARRGPH
HYELSSVQVDTFRANLFCTDPECLGALRARFGVTNEDRAEGGPHFRLEWAPRPAELPEVEYRRLGLQPLWTGAPGEPREVVGTPSFLEEVLRVALEHGFRLDSVFPDPED
LLNSRSLRFVRH*
9 >lcl|NP_001033642.1|Plus1127639..128691 NW_001494704 progestin and adipoQ receptor family member VII PAQR7 __SEG__ Chr2 {Bos taurus} MATIVAQKLSHLLPSLRQVHQEPQPSVPSEPVFTVDRAEVPPLFWKPYIYVGYRPLHRTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLAIFVGTVDFWGDPHALPLF
IIVLASFTYLSLSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQTIFLPTAAFLAWLSCTGSCYNKYIQKPGLLGRTCQEVPSALAYALDI
SPVAHRILVSPDPATDDPALLYHKCQVVFFLLAAAFFSAFMPERWFPGCCHVFGQGHQLFHVFLVLCTLAQLEAVALDYEARRSIYEPLHTRWPHNFSGLFLLTVGSSIL
TAFLLSQLVRRKLDLHRKTQ*
10 >lcl|NP_001035652.1|Plus1complement(4294052..4294636) NW_001494832 high mobility group protein B4 HMGB4 __SEG__ Chr3 {Bos taurus} MGKRDQLKPKANVSSYIHFLLNYRNKFKEQQPNTYLGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYFGRRKKRRKRDPHAPRRPPSSFLLFCQDHYAQ
LKSENPSWSVVQVAKASGKMWSAKTDVDKQPYEQRAALLRAKYREELSVYRNQFNARKTCLQESATNQCREFEQAESDTTDGSN*
11 >lcl|NP_001039430.1|Plus1complement(2347709..2348434) NW_001494583 phosphatase, orphan 2 PHOSPHO2 __SEG__ Chr2 {Bos taurus} MKILLVFDFDNTIIDDNSDTWIVQCAPEKKLPLELKDSYKKGFWTEFMGRVFKYLGDEGVREDEMKRAMISMPFTPGMVELLNFIRKNKNKFDCIIISDSNSVFIDWVLE
ATNFHDVFDKVFTNPAAFDSNGHLTVEKHHTHSCTRCPQNLCKNVVLVEFVGEQLQQGVNYTRIVYIGDGGNDVCPVTFLKKNDIAMPRKGYALQKTLYRMCQNLEPMES
SVVSWSSGVEIISYLQFLIKE*
12 >lcl|NP_001039691.1|Plus1complement(1061141..1063102) NW_001495330 protein fem-1 homolog A FEM1A __SEG__ Chr7 {Bos taurus} MDLHTAVYNAARDGKLQLLQKLLSGRSREELEELTGEVASGGTPLLIAARYGHLDVVEYLVDRCGASVEAGGSVHFDGEIIEGAPPLWAASAAGHLDVVRSLLRRGASVN
RTTRTNSTPLRAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCNARMERDGYGMTPLL
AASVTGHTNIVEYLIQEQPAGDEQAQPGLARVQPQGARSSPEEPPSGESYESCCPTSREAAVEALELLGATYVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPPQLVL
AYDYSREVNTTEELEALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQQNNLEPLSPMTASSFLSFAELFSYVLQDRSAKGSLG
TPIGFADLMGVLCKGVREVERALQLPKEPGDSAQFTKALAIILHLLYLLEKVECTPDQEHLKHQTVYRLLKCAPRGKNGFTPLHMAVDAETTNVGRYPVGRFPSLQVVKV
LLDCGADPDSRDFDNNTPLHIAAQNNCPGIMNALIEAGAHMDATNAFKKTAYELLDEKLLAKSTIQPFNYVTLQCLAARALDKNKIPYKGFIPEELEAFIELH*
13 >lcl|NP_001039936.1|Plus1177348..178391 NW_001493705 Cdc42 effector protein 4 CDC42EP4 __SEG__ Chr19 {Bos taurus} MPILKQLVSSSVHSKRRSRVDLTAEMISAPLGDFRHTMHVGRAGDAFGDTSFLNSKAGELDGESVDEQAPSSSSSSKRSLLSRKFRASKRSQSVTRSDREQRDVLGSLRD
SALFVKNAMSLPQLNEKEAAEKGSSKLPKSLSSSPVKKASAEGSLEEAAPPRNGAAAPHSPDPLLEEQAFGDLADLPMVPKASFGLKHAESIMSFHIDLGPSMLGDVLSV
MDKGGEWEPEGAPDDGGYHGDGDPAAIPASAPQAAGQEGEGGPDVPSRALQDEGWAAAAAPSPGSARSAGSHTTRDSSSLSSCTSGVLEERSPAFRGPERAPAALPAQPP
DPEFSFMDEEEEDEIRV*
14 >lcl|NP_001068635.1|Plus1470106..471467 NW_001508735 armadillo repeat containing, X-linked 1 ARMCX1 __SEG__ ChrX {Bos taurus} MGRTREAGCVAAGVVIGAGACYCVYRLTWGRDENEIIWNEDDDEEGESHDISETGKGAKANAGAGAGARLQGESKAKAEVAVELKSGPDVKAEAHSKAERGGGLEAKAKA
LFSTLKEQASAKAVKAAKLGTIFGTRALAPGLPCPGVRGGGCHPVRNGARAGSKASGKSKGRARNKSTRTPAMLWPVRKGKFNFPYKIDDILGATDLQKVLNILERSNDP
FIQEVALVTLGNNAAYSFNQNAIRELGGLPIIAKLIKTKDPIIREKAYNALNNLSVNSENQGKIKTYISQVCDDTMICRLDSAVQMAGLRLLTNMTVTNHYQHLLSYSFP
DFFALLFLGNYFTKIQIMKLIINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKNEGLASSRKEFSRSSLFFLFKESGVCVKKIKALANHSDL
VVKVKVLKVLTKL*
15 >lcl|NP_001068868.1|Plus11846543..1847208 NW_001494275 fumarylacetoacetate hydrolase domain containing 1 FAHD1 __SEG__ Chr25 {Bos taurus} MAASRPLSRFWEWGKNIVCVGRNYADHVREMQSAAPSEPVLFLKPSTAYAPEGSPVLVPAYTRNLHHELELAVVMGKRCRAVSEAAAMDYVAGYALCLDMTARDVQDECK
KKGLPWTLAKSFTASCPVSAFVPKEKIPDPHNLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIMTLEEGDIILTGTPKGVGPVKENDEIQAGIHGVLSMKFKVERPE
Y*
16 >lcl|NP_001068992.1|Plus1complement(1179087..1180322) NW_001493772 transmembrane protein 22 TMEM22 __SEG__ Chr1 {Bos taurus} MDTSPSKKYPVKKRVKIHPNTVMVKYTSHYPQPGDGGYEEINEDYGSFMEENSKKGLLSEMKRKGRTFFGTMDTCPPTEDPVTNEIGQFQSFAEKNIFQSRKMWIVLFGS
ALAHGCVALITRLVSDRSKVPSLELIFIRSVLQVLSVLVVCYYQEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSGILAFLLVDEKMACV
DMATVVCSIVGVCLVMIPNIVDEDDSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKEKISMWTALFTFGWTGTVWGISTMFVLQEPIIPLDGETWSYLIAICICSTAA
FLGVYYALDKFHPALVSTVQHLEIVVAMVLQLLVLHIFPSVYDVFGGVIIMISVFVLAGYKLYWRNLRRQDYQEILDSPIK*
17 >lcl|NP_001069006.1|Plus1complement(538183..538794) NW_001508851 RAB9A, member RAS oncogene family RAB9A __SEG__ ChrX {Bos taurus} MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDAQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYAD
VKEPESFPFVILGNKVDISERQVSAEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDPLIQTDTVRLHRKPKPSSSCCGS*
18 >lcl|NP_001069009.1|Plus1520397..521002 NW_001508751 RAB9B, member RAS oncogene family RAB9B __SEG__ ChrX {Bos taurus} MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYAD
VKDPEHFPFVVLGNKVDKEDRQVTTEEAQSWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC*
19 >lcl|NP_001069296.1|Plus1complement(243548..243883) NW_001493867 GTP-binding protein 8 GTPBP8 __SEG__ Chr1 {Bos taurus} MAAHRLRQSVGRLFAMGPELGSGRRAFSAFQAFTEVLRLPSKQLTKLVFPLEELHEHFVPGSRPDLHLNIFHPSLEDIARAESFFTASARNRIEYLTSAVRLDHAPDLHR
PE
20 >lcl|NP_001069415.1|Plus1complement(494468..495670) NW_001495107 F-box/LRR-repeat protein 14 FBXL14 __SEG__ Chr5 {Bos taurus} METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGH
AFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSL
KHISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGINRMVRQMH
GLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKVR*
21 >lcl|NP_001069748.1|Plus11061656..1062462 NW_001494990 splA/ryanodine receptor domain and SOCS box containing 2 SPSB2 __SEG__ Chr5 {Bos taurus} MGQTALAGGSSDPSTPQALYPDRSRPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLCFERRPVAQSTDGARGKRGYSRGLHAWEISWPREQRGTHAVVGVAT
ARAPLQADHYAALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPPGPQGEPLEVPERLLVVLDMEEGTLGYAVGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRINYLGER
RGEAWDGCGASVRSLVAVVWDGCSAPYNHRGNGPSSDWSATQFSARIG*
22 >lcl|NP_001070424.1|Plus1complement(2239268..2241121) NW_001495421 kelch-like protein 9 KLHL9 __SEG__ Chr8 {Bos taurus} MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGLNTVGLKKIIDVI
YTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAAC
RWLRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWRSL
APMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHA
GTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVV
GGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS*
23 >lcl|NP_001070543.1|Plus1131638..132663 NW_001493674 transducer of ERBB2, 1 TOB1 __SEG__ Chr19 {Bos taurus} MQLEIQVALNFIISYLYNKLPRRRVNIFW*RA*KTS*EEI*RALVS*KAIQRIRVLDVYT*GRKWTQ*LNKHPKRAVWTLMMCVAICHRILVFGSTRLRFPTKLVKRDQ*
RCFMWMIIMKMDASWIRRSKTALTQRPRFLCP*VTQPHQCPALHRLPLVTLLP*ALPSCPGPLSL*PSPLPLSLPPSLALPK*RIVAAATRLHVLLLLTSA*M*MTS*SR
KPSLPQCTLCMGLAWVTSSSRSNSSSHLSHHHRRSSSNSRKPLLFLLMPRNLFFLICRVKVVPMECSQVTAPLTSVLSSTVMPLMYLRPMEASTRSLL*MA*ILA*ITCS
ILTSNSSLLWLT
24 >lcl|NP_001070582.1|Plus1complement(1984489..1984770) NW_001494083 HIG1 domain family, member 1D HIGD1D __SEG__ Chr22 {Bos taurus} MSSDTDISLSSYDEDQGSKLIRKAREAPFVSIGMAGFAAIVAYGLYRLKSRGHTKMSVHLIHMRVAAQGFVEGAMTLGTGYSLYQEFWGKPKP*
25 >lcl|NP_001071390.1|Plus1complement(3151682..3152272) NW_001492971 rho-related GTP-binding protein RhoB precursor RHOB __SEG__ Chr11 {Bos taurus} MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNV
PIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL*
26 >lcl|NP_001071403.1|Plus1complement(84578..86215) NW_001493546 suppressor of hairy wing homolog 2 SUHW2 __SEG__ Chr17 {Bos taurus} MEPPCMLCEEDQEPEPQKSVGETKQVDDEDAELIFVGVEHVNEDADLIFVGMTSNSKPVVSNILNRVTPGSCSRRKRYGHFRKDNAHKLQPVSHVTRTSEAKIVLPVSDS
ESRSTDSPIIIEPLSKPDYKNISPQIVPNSFSELCSPLITFTSSLQHPVETTVSAGDMNKSPRVSKRLSTSETNSTNPKRPKLSDGIIGEHSLALSPSGIFQQNFLTTQQ
SKPDSVHTSLSHVQNGEPCPTAFAKDNVHCKPVSPLGENGLTKSDFPSLASQKKIVDPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTAFKCLSCLKVLKNLKFMNHMKHH
LELERQRGDSWKNHTTCQHCHRQFPTPFQLQCHIESVHTSQEPSTVCKICELSFETDQVLLQHMKDNHKPGEMPYVCQVCSYRSSVFADVDAHFRAYHGNTKNLLCPFCL
KIFKTATPYMCHYRGHWEKSFHQCSKCRLQFLTFKEKMEHKTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPELVEVASITVNISDSEPSPPKSKSRSSKKPC*
27 >lcl|NP_001071405.1|Plus1complement(1390219..1392249) NW_001495460 zinc finger and BTB domain containing 5 ZBTB5 __SEG__ Chr8 {Bos taurus} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALSSSQSGEEQPAPMSSSLRGNLDQRTPFPMRRLHKRKQSAEERARQRLRPTLDESAISDVTPE
NGPGVHSREEFFSPDSLKIVDNPKADGMADNPDDSTIMFDQSFSAQEDAQVPSQSDNSASNMAQLSMASRATQVETSFEQETTAEKSAFQCENPEVGLGEKEHMRVVVKS
EPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGSNFSTNQNNDDNLPNTTSDCRLE
GEAPYLLSPEAGPASGPSSAPGAHVENPFSEPSDSHFVRPMQDVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMMGSPRGGASNFPYYRRIAPKMPVVTSVRSS
QIPENSASSQLMMNAATSSFENGLPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSK
TTCLRWQSSNLPSTLL*
28 >lcl|NP_001071419.1|Plus1336251..337384 NW_001493769 progestin and adipoQ receptor family member IX PAQR9 __SEG__ Chr1 {Bos taurus} MPRRLQLRSAGTKGPPGTIAAASEAASRPHALASGDSPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGR
DVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYVQQRLGWHVDCTGLIAAYRALVLPVAFVL
AVACTVACCKSRTDWCSYPFALRTFVFIMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVE
EGLRQFLKEPPDAPTFLGTVGYMLLLVVCLGLVIKKFLSNAEFCSKK*
29 >lcl|NP_001071535.1|Plus1198077..199846 NW_001493918 ectodermal-neural cortex (with BTB-like domain) ENC1 __SEG__ Chr20 {Bos taurus} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDAWNSITTVPYSLIPTAFVSTWKHLPS*
30 >lcl|NP_001071592.1|Plus1748483..749058 NW_001495183 rho-related GTP-binding protein RhoH precursor RHOH __SEG__ Chr6 {Bos taurus} MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEVRSNLPCTP
VLVVATQTDQREVGPHRASCVNAIEGKRLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRFFSINECKIL*
31 >lcl|NP_001073774.1|Plus1301693..302268 NW_001493325 ras homolog gene family, member G RHOG __SEG__ Chr15 {Bos taurus} MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPI
LLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPVKRGRSCVLL*
32 >lcl|NP_001073825.1|Plus1complement(882956..884077) NW_001493410 hypothetical protein LOC783955 C16H1orf156 __SEG__ Chr16 {Bos taurus} MTFQFNFTIEDHLEDELTSLGDGALALHSSKESLVSERQKGTHRDKKCSTEQSDLLQDHLWEHKSERNEAPSQDPDSSFGAANSSSNLEPHEEKPCLKVAKEHAVPKDLK
KVLENKVTETLPGLQHVNISIMKTTLLKENFPGENIISKSFSSHSDLISGVYEGGLKIWECTFDLLAYLTKAKVKFAGKKVLDLGCGSGLLGIMALKGGAKEIHFQDYNS
VVIDEVTLPNVVANSTLEDEENDVNEPDVKRLRRSTVAQELCKCRFFSGEWSEFCKLVLSSEKLFEKYDLILTSETIYNPDYYVPLHQTFLRLLDKNGQVLLASKVHYFG
VGGGTHLFQKFVEERNVFETRTLEIIDEGLKRCLIEMTFKYPT*
33 >lcl|NP_001074206.1|Plus1481556..482620 NW_001494821 protein KTI12 homolog KTI12 __SEG__ Chr3 {Bos taurus} MPLVVFCGLPYSGKSRRVEELRAALEAEGRAVQVVDDAAVLGAEDATVYGDSAREKALRGALRAAVERLLSRQDVVILDSLNYIKGFRYELYCLARAARTPICLVYCVRP
GSLSGGLRVAGAVDNPNRNVSVSWRPRAEEGGRPLAVGTDVLGEPQAVASLVNRRAQAEVPTESEPKEIRAADLPALVASESEKSAEHASGAFYPPELLEALALRFEAPD
SRNRWDRPLFTLVGLEEPLPLAEIRAALFENRAPPPHQSTQSQPLASGSFLHQLDQVTSQVLAGLMEAQKSAVPGDLLKLPGTTEHLRFTRPLTMAELSRLRRQFISYTK
MHTNNENLPQLANMFLQYLSQSLH*
34 >lcl|NP_001075937.1|Plus13711920..3712759 NW_001493600 apoptosis-inducing protein D PLEKHF1 __SEG__ Chr18 {Bos taurus} MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLNKRKYRSQHIIPLEEVTLETLPETLQAKNRWMIKTAKKSFV
VSAASATERQEWISHIEECVRRQLLATGLQPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFLLPRLSSKPLRVCSLCFRELAAQKRKEDV
EEQGLGSPGPSAHLAGAVCGASSGDDDDSDEDREGSGDGDWPSHVEFYASGVSWSSFHS*
35 >lcl|NP_001076856.1|Plus1complement(1554967..1556004) NW_001495111 transducer of ERBB2, 2 TOB2 __SEG__ Chr5 {Bos taurus} MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPDKPLKGSGFRCVHIGEIVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVK
VLYVDDSEGCVAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAAGGGGVASGGAGGPQPPQQQPRL
ARSPTNNLLKQKSLSLSLHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDGADGPGSGSPASFGGSGAGTCNSSSFDVAQVFGGGANSLFLEKTPFVEGLSYNLNT
MQYPSQPFQPVVLAN*
36 >lcl|NP_001091619.1|Plus1complement(182603..183352) NW_001493257 pleckstrin homology domain containing, family F (with FYVE domain) member 2 PLEKHF2 __SEG__ Chr14 {Bos taurus} MVDRLANSEANTRRINIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFA
VYAATATEKSEWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGDMATCQ
PARSDSYSQSLKPPLNDVSDDDDDDDSSD*
37 >lcl|NP_001092189.1|Plus180619..81209 NW_001494802 ankyrin repeat domain 13C ANKRD13C __SEG__ Chr3 {Bos taurus} MTGEKIRSLRRDHKPSKEEGDLLEPGDEEAAAALGGTFTGGRLGTGGSGKSGRACHKIFSNHHHRLQLKTAPASSNPPGPPALPLHNSSATPISQSPALLAGTSPIAVVA
GGGGCPAHYPVHECVFKGDVRRLSSLIRTHNIGQKDNHGEESSPRPPFLPRACTYSGLSNPRFLYILGFYRTLLSSPLPIIRAKCP*
38 >lcl|NP_001092864.1|Plus1complement(1810317..1811210) NW_001495460 mitochondrial carrier triple repeat 1 MCART1 __SEG__ Chr8 {Bos taurus} MMDSEAHEKRPPILTSSKQDIAPHIATVSEMKHYLCGCCAAFNNIAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLR
KHVSTPEFATRSMAAVLAGTTEAIFTPLERVQTLLQDHRHHDKFTNTYQAFKALKCHGIREYYRGLVPVLFRNGFSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGL
LGAMLGILFFPVNVVKTRMQSQIGGEFQSFPKVFQKIWLERDRKLTNLFRGAHLNYHRSLISWGIINATYEFLLKII*
39 >lcl|NP_001094559.1|Plus1419858..420871 NW_001493091 abhydrolase domain containing 13 ABHD13 __SEG__ Chr12 {Bos taurus} MEKSWMLWNFVERWLVALASWSWALCRISLLSLIVTFHLYGGIVLLLLIFISIAGILYKFQDVLLYFPEQPSSSRLYVPMPTGIPHENIFIRTKDGVRLNLILIRYTGDS
SPYSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFL
SIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSPSPEEMAKT
SSNVTII*
40 >lcl|NP_001094565.1|Plus11792855..1793502 NW_001493664 acyl-malonyl condensing enzyme 1-like 3 AMAC1L3 __SEG__ Chr19 {Bos taurus} MAYQASHFPSLELLICRCLFHLPIALLLKLRGDPLLGPPDVRGRACLHALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTVCSALLALCLESQRLSGYDWCGLLGSTLGL
IIIVGPGLGTLQEGTTGLYTALGYVLAFLGGLALSLGLLVYRSLDFPSCLPTVAFLFGLVGLVGSVPGLFMLQTPVLPKDPLSWSCVGAVGILALVSFVCVSYAVT
41 >lcl|NP_001094605.1|Plus11117315..1118379 NW_001494165 progestin and adipoQ receptor family member VIII PAQR8 __SEG__ Chr23 {Bos taurus} MTTAILERLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAEGLPWASAYTL
PLLVYVLSSITYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYTSDQAWYEHFWLLFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPSGLA
YILDISPVVHRVVLCHLSGCQDPAAWYHTLQIIFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHTFLSVCTLSQLEAILLDYKGRQDIYLPRHSPLSIYLACLSFFLV
VGCSAGTAAFLRQKIKARLTKKDS*
42 >lcl|NP_001095382.1|Plus1717931..718572 NW_001492869 hypothetical protein LOC509393 MGC166084 __SEG__ Chr10 {Bos taurus} MDELVHDLASALEQTSEQNKLGELWEEMALSPRQQRRQLRKRRGRKRRSDFTHLAEHTCCYSEASESSLDEALKDCREMAPVTNFSDSDDTMVVKRHPALNAIVKSKQHS
WHESDSFTENAPCRPLRRRRKVKRVTSEVAASLQQKLKVSDWSYERGCRFKSAKKQRLSRWKENTPWTSSGHGLCESAENRTFLSKTGRKERMECEADEQKQGS
43 >lcl|NP_001095425.1|Plus1339743..340933 NW_001494142 kelch repeat and BTB (POZ) domain containing 1 KLHL31 __SEG__ Chr23 {Bos taurus} MAPKKKTVRKNKADVNEMTIIVEDSPLNKLNALNGLLEGGNGLSCISSELTDASYGPNLLEGLSKMRQEGFLCDLVISTKTKSFDVHKSVMASCSEYFYNILKKDPSTQR
VDLNDIAPLGLATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLVKMCSDFLIQEMSVENCMYIANIAETYSLRNAKAAAQKFIRDNFLEFAETDHFMKLTFEQINELL
IDDDLQLPSEIVAFQIAMKWLEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHKLLVDAMNYHLLPYHQNTLQSRRTRIRGGCRVLVTVGGRPGLTEK
SLSRDVLYRDPEIGWSKLTEMPAKSFNQCVAVMDGFLYVAGGEDQNDARNQAKHAVSNFCRYRLFY*
44 >lcl|NP_001095483.1|Plus1762461..763870 NW_001494910 kelch repeat and BTB (POZ) domain containing 2 KBTBD2 __SEG__ Chr4 {Bos taurus} MVEHKFTAVYHQEAFMQLSHDLLIDILSSDNLNVEKEETVREAAMLWLEYNTESRSQYLSSVLSQIRIDALSEVTQRAWFQGLPPNDKSVVVQGLYKSMPKFFKPRLGMT
KEEMMIFIEASSENPCSLYSSVCYSPQAEKVYKLCSPPADLHKVGTVVTPDNDIYIAGGQVPLKNTKTNHSKTSKLQTAFRTVNCFYWFDAQQNTWFPKTPMLFVRVKPS
LVCCEGYIYAIGGDSVGGELNRRTVERYDTEKDEWTMVSPLPCAWQWSAAVVVHDCIYVMTLNLMYCYFPRSDSWVEMAMRQTSRSFASAAAFGDKIFYIGGLHIATNSG
IRLPSGTVDGSSVTVEVYDVNKNEWKMAANIPAKRYSDPCVRAVVISNSLCVFMRETHLNERAKYVTYQYDLELDRWSLRQHISERVLWDLGRDFRCTVGKLYPSCLEES
PWKPPTYLFSPDGTEEFEMDGEMVALPPV*
45 >lcl|NP_001095613.1|Plus1complement(483749..484357) NW_001501749 hypothetical protein LOC532145 MGC148542 __SEG__ Chr23 {Bos taurus} MLRQVLRRGLQSFCHRLGLCVSRHPVFFLTVPAVLTITFGLSALNRFQPEGDLERLVAPSHSLAKIERSLASSLFPLDQSKSQLYSDLHTPGRYGRVILLSPPGDNILLQ
AEGILQTHRAVLEMKVNYKGYNYTFSHLCVLRNQDKKCVLDDIISVLEDLRQAAVSNKTTARVQVRYPNTKLKVCSSCMLLPIKEAALHFLP*
46 >lcl|NP_001096001.1|Plus1complement(121510..122061) NW_001493744 RAP2B, member of RAS oncogene family RAP2B __SEG__ Chr1 {Bos taurus} MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVP
MILVGNKVDLEGEREVSFGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL*
47 >lcl|NP_776430.2|Plus1246996..248762 NW_001495460 calicin CCIN __SEG__ Chr8 {Bos taurus} MKLEFTEKNYNSFVLQNLNKQRKRKEYWDIALTVDHHVFFAHRNVLAAVSPLVKNLISNHDMKTTDELFITIDPNYLSPTTVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCNDFLIKSIRRANCLRYLFLAELFELKEVSDLAYSGIRDNFHYWASPEGCVHFMRCPPVIFGRLLRDENLHVLNEDQALNALINWVCFRKDEREKYFKKFF
NYINLNAVSNKTLMYASNKLMGMENSSAHSTLIESVLVDRKQERPTSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATSAGRYIY
ISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKETWCLAGKMSIPMDGTAVITRGDRNLYIVTGRCLVKGYIS
RVGVVDCFDTNTGEVVQCITFPIEFNHRPLLSFHQDNILCVYSHRQSVEINLQKVKANKTTTSVPLLPNNCPLDVSHAICSVGDNKVFVCGGVTTTTDVQTKDYTINPNA
YLLDQKAGEWKTLAPPPEALDCPACCLAKLPCKILQRI*
48 >lcl|NP_776918.1|Plus1<89094..90050 NW_001493613 tristetraproline ZFP36 __SEG__ Chr18 {Bos taurus} QSLLSLSPELPSDLGETESSTSWASSGPWSLSSSDSSLPEVAARLPGRSTSLVEGRSCGWVPPPPGFAPLAPRPSSELSPSPTSPTATPTTSSRYKTELCRTFSESGRCR
YGAKCQFAHGLGELRQASRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPHVLRQSISFSGLPSGRRTSPPPASLAGPSVSSWSFSPSSSPPPPPGDLLLS
PSAFSAAPGTPVSRRDPTPACCPSCRRATPNSVWGPVGGLARSPSAHSLGSDPDEYASSGSSLGGSDSPVFEAGVFGPPQPPAAPRRLPIFNRISVSE*
49 >lcl|XP_001250140.1|Plus1complement(1129260..1129637) NW_001495231 josephin-1-like LOC781671 __SEG__ Chr6 {Bos taurus} MEGNYDVNVLMAALQTKGYEAVWWDKRRDVDAIALTNITGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGKSELRKFLKHHLRGKNCEFLLV
VPEEVEAHQSWRADV*
50 >lcl|XP_001250807.1|Plus1complement(2040430..2041413) NW_001495544 FtsJ homolog 1 LOC783071 __SEG__ Chr9 {Bos taurus} MGWSSKDKRDVYYRLAKEKGWRARSAFKLLQLDEEFQLFQGVTRAIDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVLQIQGDITQLSTAKEIIQHFEDCPT
DLVVCDGAPDVTGLHVEYMQAQLLLAALNLAMHVLKPGGCFVGKIFRGRDVTLIYSQLRVFFSRVLCAKPRSSRNSSIEAFAVCKGYNPPEGFLPDLTKPLLDHSYDFNQ
LDGLSRIIVPFVTSGDLSAYDSDCSYPLDLEDGSEYKCTPPRQPPISPPYQEASTLKEKGQLAKDKEIRPQDCPTSTVDRMPQSLTVPQRHTLQPSEVEDSGVNYSS*
51 >lcl|XP_001250935.1|Plus1complement(2364249..2364887) NW_001493221 hypothetical protein LOC782385 __SEG__ Chr14 {Bos taurus} MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHVIGFAFEYFANSQFHDCSDHVCFISPEVTQFIKCTGNPAEIAMFLEPLDLPNKRVIFLAINDNSNHTAGGTHWSLLVYLQ
DKNGFFHYDSYGSSNSFHAKQVAEKLEAFLGRKGNKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQPQSLLQLLTPTYITKKREEWKDLIARLAKN*
52 >lcl|XP_001250987.1|Plus1complement(2375825..2376463) NW_001493221 hypothetical protein LOC782438 __SEG__ Chr14 {Bos taurus} MDPVVLSYMDSLLQQSDVSLLDPPSWLNDHVIGFAFEYFANSQFHDCSDHVCFISPEVTQFIKCTGNPAEIAMFLEPLDLPNKRVIFLAINDNSNHTAGGTHWSLLVYLQ
DKNGFFHYDSYGSSNSFHAKQVAEKLEAFLGRKGNKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQPQSLLQLLTPTYITKKREEWKDLIARLAKN*
53 >lcl|XP_001251925.1|Plus1complement(731247..731561) NW_001492942 enhancer of rudimentary homolog LOC783761 __SEG__ Chr11 {Bos taurus} MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEYLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRGQAQQAGK*
54 >lcl|XP_001252476.1|Plus1337922..338947 NW_001493674 transducer of ERBB2, 1 isoform 1 TOB1 __SEG__ Chr19 {Bos taurus} MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHVGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVK
VLYVDDNNENGCELDKEIKNSFNPEAQVFMPVSDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQK
AISSSMHSLYGLGLGNQQQPQQQQQPSQPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQY
SNQQFQPVMAN*
55 >lcl|XP_001253205.1|Plus1complement(7734308..7735468) NW_001492939 hypothetical protein LOC785063 __SEG__ Chr11 {Bos taurus} MEGPAEYRARDRQAEMEQPVGGALGGSPEQRASVRPRPKEPEDAAGDRADPFDPVEGTPSAPLGRRPRGGLVGEGARPEPLGDAPPTPRPGRTAPRDPAAGGSPQLRRGP
GGADGAAAEEEGAGSLTLDPLEHAWMLSAADGRWDSLEGLLACEPGLLAKRDFITGFTCLHWAAKHGQQELLALLVRFAGQHRLPVNINARTSGGYTALHLAAMHGHVEV
VKLLVGAYDADVDVRDYSGRKASQYLSPSTAEEIRTLVGALDEDEGESAAGSGGGRWRLSRVLPSHLISGRLSHALEDGGDHHHHLAEGLTAGKAKEPNRKASGSSSGRM
KPRLNKIRFRTQIIHTTPSFRDPEQPLEEGEDEEEDRSLKGHSSSFKLRPKSNVFG*
56 >lcl|XP_001253361.1|Plus11876630..1877295 NW_001494275 fumarylacetoacetate hydrolase domain-containing protein 1-like FAHD1 __SEG__ Chr25 {Bos taurus} MAASRPLSRFWEWGKNIVCVGRNYADHVREMQSAAPSEPVLFLKPSTAYAPEGSPVLVPAYTRNLHHELELAVVMGKRCRAVSEAAAMDYVAGYALCLDMTARDVQDECK
KKGLPWTLAKSFTASCPVSAFVPKEKIPDPHNLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIMTLEEGDIILTGTPKGVGPVKENDEIQAGIHGVLSMKFKVERPE
Y*
57 >lcl|XP_001254187.1|Plus1216150..217070 NW_001508751 mitochondrial carrier triple repeat 6 LOC786529 __SEG__ ChrX {Bos taurus} MGEQNHSPGKELQHWTQKEAPGKRSWHSHAYALGAISNFMSTFLTFPIYKVVFRQQIHAVAVSEALRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSMLCCLSPVG
PHSLGNRWAAGLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTISILKEFHSYGLWGRLSQGYYRGFWPILLRNSLGSALYFSFKDPIQNSLAEQGLPHWVPALVSGSV
NGTITCLVLYPLIVLVANMQSHIGWQSMPSLWASIQDVWDTRGRKVFLIYRGGSLVILRSSVTWGLTTAIHDFLQRRYHSRKEPKD*
58 >lcl|XP_001255010.1|Plus1837804..839309 NW_001493276 mCG56896-like LOC787716 __SEG__ Chr15 {Bos taurus} MGAVNSQMPSNRVGHAPEEPGAPEGEEEAEEVAVAVIEEGEESEEARPTTSQGRHKRKTGPEGQLTKAPHRKRAKDRLESVYKTLFLRGEGSDVQIRALGKEWNLHKVYL
CRSGYFASMFSGAWRETTMDTVELQMPDENIDREALHEALGSLYRNSVLIPPGRVVPMLATASMLQLDKLIQQCGEIMKETVSDETVCSYYCSAESDGLQNIRAMCLQWL
LDNLMTQHSEELLREVSLDLMKEVIASSELFMMEVEMDVYTTLKKWMFLQLQPTWRGPRRDLLPDADSWFARSRQESEGTPFLETEQGRAFVPAFQQLRLAYMICDLPSA
RIIDQDALIPATWLTPVYKEQWLALLQAEQTRDLGPVDVFVSDLQRTSMRCGGQLLRDKQCTWRWAGFNVGWDLVVCYANRRIIFKRSVLNKSCGLGVSLLWQRKVAFRL
RLASLDRAGRAIFRKETELQVLSLGKDEELEVVNLENEDVVFPIYVTCNFLYLPREGRFPE*
59 >lcl|XP_001255260.1|Plus1complement(3402418..3402972) NW_001495330 RAP1B, member of RAS oncogene family LOC789148 __SEG__ Chr7 {Bos taurus} MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVP
MILVGSKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLARQINRKTPVPGKAHKKSSCQLL*
60 >lcl|XP_001256023.1|Plus13834793..3836388 NW_001494547 hypothetical protein LOC789200 __SEG__ Chr29 {Bos taurus} MFISAASVAPGTAGPCRPGPPGPPPPLLPKPGKDNLRLQKLLRKAARKRMGGGGPPAPPGAFRTSLSPVSEASRDQEAPSPRPMEAPRPAELPRPTEAPRPTEALHPREA
PRPANALHPTEAPRLAEALHPLEAPHPVEVPRPAEAMRPSDTPHPTDAHHPAEAPHPAEAPVAVAATPRCPPTPVIHHVASPTQRSTFSFSLAQRRSLASHFRATGPQLT
ALAPEPARCPSGFTQVVAPAVRGSHVSQVHVRLVPSPQGGTPEPPPAAPQDQHMAPCPPGAQPLIPVAHIRPLPTGTQVASPWPAASPVPRPPSGLQASVPREAGTRVVV
PITPTYRSPGPSPFRPGSGTPEPGRLEEPPTAGPATEAERVSSSRGASPPAPLAGPHPCPAPRAAARPQLSGWMRLKKQLLEEPEEPKFPGPEPSPGQVDQGETTLASLE
PRPPASRASKMWDAVLYRVSVAESRSGQAGPGAGVCTLAGLRRLPFLYRPRFNARKLQEVAARPHPVTSPVLVLNPQPKNFNRTAAGWRLH*
61 >lcl|XP_001787532.1|Plus1423953..425182 NW_001494490 hCG1799097-like LOC100139585 __SEG__ Chr29 {Bos taurus} MAMPESQDDWSKEDIMQLLECMEKNIPSNNRHTFKVTQSVMDWGKVAFKDFSGEMCKLKWLEISYNLRKFRTLKELILEAKENINNSKRKKHKKHPDLPKKPLTAYLRFF
KEMRPQYLQKHPKMSNQELIKVLSEEYRKLPEQLKLKYSQDFQKEKQEFQEKMTLFREQHPELVRNSKKPNVPKGSQSKVPKKFQEHVQKVKPPPENHLPVKWKFHGEPE
KPPMNGYHKFHQDLWSSRELKVVPPRERMVEISRRWQRVPQDQKELYKKQAEELQTQYKVDLDLWLRTLSPEEYAAYREVTCAKPKNMSMMGGPNPKIRRMGLQSPSSGN
LQGRLKEDPVFQAAELASSDTTGEHSPTSGRSEENEEDAEGDATNSSDQCREDVDCKFESTGDEDKDCDVESTVCNSPS*
62 >lcl|XP_001787586.2|Plus1complement(643636..644850) NW_001494490 Putative upstream-binding factor 1-like protein 3/5-like LOC523762 __SEG__ Chr29 {Bos taurus} MVLPKSQDDWSKEDIVQLLEYMEKSIPSNDRHTFKTTQSMVDWEKVAFKDFSGEKCKLKWLEISYNLRKFHTFKEVIQEAKENVNNPSKSRNHKKHPDLPKRPLTAYLLF
FKEMRPQYLQKHPKMSNQELTKVLSEEYRKLPEHLKLKYSQDFQKEKQEFQEKMVLFREQHPKLVQNSKKPDVPKGSRSKVPKKFQENVQKVRSSPENNLPMKWKFHGEP
KKPLMNGYHKFHQDLWSSRELKVVPPREHMVEISRRWQWVPQDQKELYKMQAEGLQTQYKVDLDLWLRTLSPEKYAAFREVTCAKCKNMSMMGSPNPKIRRMGLQSPSSG
NLQGRLREDPGLQSEESETSDTIGEHCPSSGRSEENKEEEAGSSSSAPSTEDEDGDSELEDSSSSLLSSGDSSD*
63 >lcl|XP_001787630.2|Plus1complement(982813..983136) NW_001494782 poly(rC) binding protein 1-like LOC781360 __SEG__ Chr3 {Bos taurus} MMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSRAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS*
64 >lcl|XP_001787974.1|Plus1<635830..636633 NW_001494378 nanos homolog 1-like NANOS1 __SEG__ Chr26 {Bos taurus} RYVSTQGPAHPQPFSSWNDYLGLATLITKAVDGEPRFGCARGGDGGGDGSPPSSSSSSCCSPHVGAGPGALGPALGPPDYDEDDDDDDSDDPGSRSRYLGGALELRALEL
CADPAEAGLLEERFAELSPFAGRAAAVLLGCAPAAAAAATAEAAPREERAPAWAAEPKLHAASGAAAARLLKPELQVCVFCRNNKEAVALYTTHILKGPDGRVLCPVLRR
YTCPLCGASGDNAHTIKYCPLSKVPPPPAARPPPRSARDGLPGKKLR*
65 >lcl|XP_001788325.2|Plus1complement(1467543..1468535) NW_001493888 WD repeat domain 5 WDR5B __SEG__ Chr1 {Bos taurus} MTTEQSGNAKAEPALPSSANQSKPVSEKPNYALKFTLEGHTEAVSSVKFSPNGEWLASSSADKVIIIWGAYDGKYEKTLKGHNLEISDVAWSSDSSRLVSASDDKTLKIW
DVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDESVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGVCRIWDAASGQCLKALVDDDNPPVSFVKFSP
NGKYILIATLDNTLKLWDYSRGRCLKTYTGHKNEKYCVFASFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENIIASAALGNDKTVKLWTSTY
*
66 >lcl|XP_001788496.1|Plus1complement(1372509..1373657) NW_001492809 ankyrin repeat domain 54-like LOC100140532 __SEG__ Chr10 {Bos taurus} MLKPKDLCPRAGTRTFLEAMQAGKVHLARFVLDALDRSIIDCRAEQGRTPLMVAVGLPDPALRARFVRLLLEQGAAVNLRDERGRTALSLACERGHLDAVQLLVQFSGDP
EAADSAGNSPVMWAAACGHGAVLEFLVRSFRRLGLRLDRTNRAGLTALQLAAARGHGTCVQALTGPWGRAAAAAAARGSNSDSPPGRPVPAPSPERRRPSPRRLPRPLLA
RFARAAGGHGHGGEAGSGGKGFGRHRPQGCERPELGRSMSLALGAVTEEEAARLRAGALMALPHSPQSSGAGRWRSQEVLEGAPPTLVQAPIGLSPHPEGDPGSGRLGLR
RRSTAPDIPSLVGEASGPESGQELEPNALPHSVPGPQPWQGGTEAVVLHAQR*
67 >lcl|XP_002684090.1|Plus1complement(4282417..4282698) NW_001494615 HIG1 domain family, member 1D-like LOC100295503 __SEG__ Chr2 {Bos taurus} MSSDTDISLSSYDEDQGSKLIRKAREAPFVSIGMAGFAAIVAYGLYRLKSRGHTKMSVHLIHMRVAAQGFVEGAMTLGTGYSLYQEFWGKPKP*
68 >lcl|XP_002684216.1|Plus1complement(3063483..3064640) NW_001495055 MTERF domain containing 3 MTERFD3 __SEG__ Chr5 {Bos taurus} MLSKLLMRSQPCRLCSFRKRLSAPKYRPFLAFFTCTTDSQSKKENKKTVEKLFKLSVDIRKIRRLKGWVLLEDETYVEEIANILQQLGASETAVASILERCPEAIICSPT
AVNTQRELWQLVCKNEEKLVKLIEQFPESFFTVKDQENRKLNIQFFQELGLKNVVISRFLTTASNIFHNPIEKNKQVIKILQESYLNLGGSEANMKVWLLKLLSQNPFIL
LNSSAAIKETLEFFQKQGFTNFEILQLLSKLKGFLFQLCPRSIQNSMSFSKNAFKSTDHDLKQLVLKCPALLYYSVPVLEERIQGLLKEGISIAQIRETPMVLELTPQIV
QYRIRKLNSLGYGIKDGHLANINGTKKEFEANFGKIQAKKGRPLFNPVAPLNVEE*
69 >lcl|XP_002700543.1|Plus11825440..1825721 NW_001492790 HIG1 domain family, member 1D-like LOC100295586 __SEG__ Chr10 {Bos taurus} MSSDTDISLSSYDEDQGSKLIRKAREAPFVPIGMAGFAAIVAYGLYRLKSRGHTKMSVHLIHMRVAAQGFVVGAMTLGMGYSLYQEFWGKPKP*
70 >lcl|XP_002700650.1|Plus1complement(1611601..1612155) NW_001492820 GTP-binding protein Rheb-like LOC100335253 __SEG__ Chr10 {Bos taurus} MPQSKSRKIAILGYRSVGKSSLTIQYVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKV
QIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAPSQGKSSCSVM*
71 >lcl|XP_002700709.1|Plus1complement(715151..715432) NW_001492865 HIG1 domain family, member 1D-like LOC100335275 __SEG__ Chr10 {Bos taurus} MSSDTDISLSSYDEDQGSKLIQKAREAPFVPIGMAGFAAIVAYGLYRLKSRGHTKMSVHLIHMRVAAQGFVVGAMTLGMGYSLYQEFWGKPKP*
72 >lcl|XP_002700851.1|Plus1complement(1491975..1492256) NW_001492944 HIG1 domain family, member 1D-like LOC100296944 __SEG__ Chr11 {Bos taurus} MSSDTDISLSSYDEDQGSKLIRKAREAPFVPIGMAGFAAIVAYGLYRLKSRGHTKMSVHLIHMRVAAQGFVVGAMTLGMGYSLYQEFWGKPKP*
73 >lcl|XP_002701412.1|Plus1complement(227272..227526) NW_001493331 E2IG2-like LOC100296470 __SEG__ Chr15 {Bos taurus} MSAQGHAWSRQVKKEDEEEDPLDQLISRSGCAASHYAVQECMAQHQDWRQCQPQVQAFRDCMSEQQARRREELQRRKEQSSTHR*
74 >lcl|XP_002701561.1|Plus14036630..4037034 NW_001493394 progestin and adipoQ receptor family member V-like LOC100296870 __SEG__ Chr16 {Bos taurus} MTLLAPIFYSAHLPQLLAPGCFDGICHSHQLFCVCGILAAHMQMEAIILDKTLRKEWLLAHSGPLLFSQIAGAILLCLVFNLNNVIYFSAALYLIPEPELHKKEHDSDHK
LFMPNVNIKLQHLNHPKPMAWYQF*
75 >lcl|XP_002701825.1|Plus1complement(410867..411715) NW_001493578 seven in absentia homolog 1 SIAH1 __SEG__ Chr18 {Bos taurus} MSRQTATALPTGTSKCAPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLP
HTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAEN
FAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC*
76 >lcl|XP_002701846.1|Plus1complement(3687294..3687575) NW_001493595 HIG1 domain family, member 1D-like LOC100294863 __SEG__ Chr18 {Bos taurus} MSSDTDISLSSYDEDQGSKLIRKAREAPFVPIGMAGFAAIVAHGLYRLKSRGNTKMSVHLIHMRVAAQGFIVGAVTLGMGYSLYQEFWGKPKP*
77 >lcl|XP_002702870.1|Plus1773412..774797 NW_001494145 zinc finger and BTB domain containing 9 ZBTB9 __SEG__ Chr23 {Bos taurus} MDTSTPLPPVAPSPACNPAPRTIQIEFPQHSSLLLEALNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPNVIEADAFEGLLQLIYSGHLRL
PLDALPAHLLVASGLQMWQVVDQCSEILRELENTGGGISSRGATPFHTLLSTTGGWCIRSSPFQTPAQSSPSTQSPIGGEGSELGDVLQLQVEEEEEEDEEDQGSAAPSQ
TPQPQRESGSFPRPPVSHPLPTSTTPCRLPEGESAPPEPPAPHTALPPKVFYIKQEPFESKEEIAGGGSQSVGAKEETKVFPAGNTEENGELGFLLPSGAGTTSGGGGPS
WKPVDLHGNEILSGGGGPGGAGQAVHGPVKLGGAPPADGKRFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGICNKRFKLKHHLTEHMKTHAGALHACPHCGRRFRVHAC
FLRHRDLCKGQGWATAHWTYK*
78 >lcl|XP_002702919.1|Plus1244757..246136 NW_001494172 zinc finger and BTB domain containing 12-like LOC100336034 __SEG__ Chr23 {Bos taurus} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGVSDASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVA
HRLKPPGGLGGGLGIGGSVGSHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGGRGPLPGGFSSGNPL
KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGK
TTAENVLEASVAEINVLIR*
79 >lcl|XP_002703318.1|Plus1989569..989850 NW_001494394 HIG1 domain family, member 1D-like LOC100336078 __SEG__ Chr27 {Bos taurus} MSSDTGISLSSYDEDQGSKLIRKAREAPFVSIEMAGFAAIVAYGLYRLKSRGHTKMSVHLIHMHVAAQGFVVGAMTLGMGYFLYQEFWGKPKP*
80 >lcl|XP_002703484.1|Plus173272..73994 NW_001494513 CG10465-like LOC100297610 __SEG__ Chr29 {Bos taurus} MNHELPGDGTVGHSASCAPQESPVVELNVGGEFYTTTLGTLRKFPGSKLAEMFSSPAKACLDAEGRFFIDRCGTYFGPILEYLRSGQLPTQHIPEVYREAQHYEIKPLIK
HLEDTPQIFGEQVARKQFLLQVPGYSENLELMVRLARAEAVAARCSRVLVCLVRNEKEDANCADALRSLEANKRSVVKFGPWKAALDISDLLDCLNMDIKAQGYQVCYSH
NSPLPAKVSDYFYTFSFSWW*
81 >lcl|XP_002704139.1|Plus1complement(190605..190886) NW_001494903 HIG1 domain family, member 1D-like LOC100298628 __SEG__ Chr4 {Bos taurus} MSSDTDISLSSYDEDQGSKLIRKAREAPFVPIGMAGFAAIVAYGLYRLKSRGHTKMSVHLIHMHVAAQGFVEGAMTLGMGYSLYQEFWGKPKP*
82 >lcl|XP_002704711.1|Plus1complement(334785..336323) NW_001495266 ankyrin repeat domain 34B ANKRD34C __SEG__ Chr7 {Bos taurus} MDECVEISSDGNSLIKAVHQSRLRLTRLLLEGGAYINESNDRGETPLMIACKTKHVDHQSVSKAKMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGAD
LSLQDHSSSSALVYAINSEDRETLKVLLSACKAKGKEVIIITTAKSPSGRHTTKQYLNMPPGGMDGCHTPATCATPSEIDLKTASPPLSHSSETETTLFGFKDLEPAGSS
DDTGDRGSPVRKPGLTPNGPKLPQAPHWIRSPPLLMHRVASLQEELQDITPEEELSYKANRLALSKRFITRHQSIDVKDTAHLLRAFDQASSRKMSFDEVNHQSFFSEGN
QQCIDIPVDQEPDSNQTIFASTLRSIVQKRNSGANHYSSDSQLSAGLTPAASDDGKAFIGKKKILSPSSSLLSGSKELLENIPPGPLSRRTHARLERRGSGAFPLDHNSY
TNQTRIPSTLKCEPSPSHIRYQCQQQDFQPSFLWSKSAYANSSYFPQRIQK*KDVVKETIIANRTN*AVS*FL
83 >lcl|XP_002705205.1|Plus11380744..1381025 NW_001495563 HIG1 domain family, member 1D-like LOC100296447 __SEG__ Chr9 {Bos taurus} MSSDTDISLYSYDEDQGSKLIRKAREAPFVPMGMACFAAIVAYGLYRLKSRGHTKMSVHLIHMRVAAQGFVVGAMTLGMGYSLYQEFWGKPKP*
84 >lcl|XP_580440.3|Plus1complement(630672..632576) NW_001494145 zinc finger and BTB domain containing 22-like ZBTB22 __SEG__ Chr23 {Bos taurus} MEPSPLSPSGAALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRASASATTVTTAAATSVTVPGAGVPSGSGGTVAPATVSSVRSHASSRASENQSPSSSNYFSPRESTDFSS
SSQEAFAASAVGSGERRTGGPVFPAPVVGSGGATSGKLLLEADELCDDGGDGRGAVVPGAGLRRPTYTPPSIVPQKHWVYVKRGGNCPASAPLAPQDPDLEEEEEEEDLV
LTCEDDEDEELGGGSGVPARGGPEATLSISDVRTLSEPPDKGEEQVNFCESSNDFGPYEGGGPGAGLDDSGGPTPSSYAPAHPPRPLLPLDMQGNQILIFPSSSSSSSSS
QPPGNQAEHGAVTLGGTLAGALGGPGGTGGTPGGTGSGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECSVCAKKFMW
RDSFMRHRGHCERRHHLGGGGGGGPGPGGGPSGPALQPKRESPCGGGGSGDEASGATPPSSRCVWSPLSVHKVEMGFSGGGGAN*
85 >lcl|XP_581896.1|Plus11518500..1519099 NW_001495487 Di-Ras2 DIRAS2 __SEG__ Chr8 {Bos taurus} MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGD
VESIPIMLVGNKCDESPNREVESSEAEVLARKWKCAFMETSAKLNLNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVVM*
86 >lcl|XP_583547.1|Plus1complement(1102..1698) NW_001501921 density-regulated protein-like LOC538904 __SEG__ Chr29 {Bos taurus} MAADISESGGHDCRGDQRSNTKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKT
VPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK*
87 >lcl|XP_584542.3|Plus1complement(224115..225296) NW_001492796 La ribonucleoprotein domain family, member 6-like LOC507856 __SEG__ Chr10 {Bos taurus} MIPDPGVTGVGKGGRAIIEGAKRTRTIGTISNLLCVLQVKHLTRDWRTTAHALKYSVTLELNEDHRKVRRTTPVPLFPNENLPSKMLLVYDLYLSPKLWALATPQKNGRV
QEKVMEHLLKLFGTFGVISSVRMLKPGRELPPDIRRISNRYSQVGTQECAIVEFEEVEAAIKAHEFMITESQGRESMKAILIGMKPPKKKPSKEKNQDEEPTSSIHLNKS
LNRRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAVANKLSPSSHQNLFLSPNASPCSSPWSSPLAQRKGVSRKSPLAEEGRPNTSASPEIVRKCADYSSDSSVTPSG
SPWVRRRRQAEMGPQEKSPRASPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGGHERSRACV*
88 >lcl|XP_584893.1|Plus1complement(1917202..1919244) NW_001493016 kelch repeat and BTB (POZ) domain containing 7 KBTBD7 __SEG__ Chr12 {Bos taurus} MQSREEAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTGHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESHQT
NVTMHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFDHHKLRSQAQSFIAHNFKQLSRMGSIREESLADLTLA
QLLAVLRLDSLDIESERTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDEDRGYLEELLTKPIVKKYCLDLVEGALQMRYGDMLSKSLVPKPESSSSSSVVSIAENP
PQRLGMCAKEMVIFFGHPRDPFLCYDPYSGDIYTMPSPLTSLAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRD
PITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDS
ETHNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSD
DEVWVQVAPQRNAQDQQGSL*
89 >lcl|XP_585983.1|Plus12577877..2579229 NW_001493595 porcupine LOC509094 __SEG__ Chr18 {Bos taurus} MATFSRQEFFQQLLQDCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSYLKHASTVVGGFFSLYHFFELHMVWVMLLSLLCYLVLFLCRRSSHRGVFVSITILTYLLMG
EMYMVDTVAWHRMRGAQMIVAMKAVSLGFDLDRGEVSMVPSPMEFMGYLCFVGTVIFGPWISFHRYLEAVQGRPLSCRWLQKVAQSLLLALLCLVLSTCVGPYLFPYFIP
LDGDHLLRKWLRAYESAVSFRFSNYFVGFLSEATATLAGTGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSCWLNNYVFKNALHLGTFSAVLVTYTASALLH
GFSFHLAAVLLSLAFITYVEHILRKRLARILSACILSRRCPSDCSHQYRLGLGVRALNLLFGALAIFHLAYLGSLFDVDVDDTTEEQGYGMAYTVHKWSELSWASHWVTF
GCWIFYCLIG*
90 >lcl|XP_588510.2|Plus1complement(1293918..1295744) NW_001492801 hepatocellular carcinoma-associated antigen 66-like UTP6 __SEG__ Chr10 {Bos taurus} MAEVIQERVEDRLPELQQLERTGLFSHAEIKAIIRKALELEYRIQRRSLLKDDFIRYVQYEINLLDLIEKRRARVGYTFKKDEIEDPIIHRIQSVFRRASIKWKDDVRLW
LSFIAFCRKWASNVHLGKIFSCLLAFHSNKPGLWILAAKWELEDRFSSESARQLFLRALRFHPRCPKLYEEYFRMELMHAEKLRKEKQEFEKANMDVGNLEHAEEILTGE
LAWIIYKNSTSVIKSAKFRVSLLSVARLFNFAKDLQREIYNDLKALHADDPITWDYVARQELVIESQPVEELPTTKQAKAKEVGCREERSCAVYEEAVKTVPTEAMWKCY
MNFCMERFTKKTSSRLLRKKSLERTMVAFWKAHELKLLPELQYRQLSKLLLHHQLLKESLEVADAGVKLFKKSVEMWQVKLEALITSESHEMSKGFEQAFEYLKPQICLP
LWLTWAQWSEDAGKQEETEAIYKRDIFGLPGADSVPVKEMYLNWAYRSGGYKKARDVFKSLQENRPFSVDFFRKMIQFEKEQESCKMENLREYYERALREFGTNDSDLWM
DHIKEELNHPLGRPENWGQIYWRAMKMLQGESIEQFMAKHALYQAGRFVKRGRAQSPL*
91 >lcl|XP_588533.3|Plus185952..86734 NW_001494508 potassium channel tetramerisation domain containing 12-like KCTD21 __SEG__ Chr29 {Bos taurus} MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNA
MLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSF
QVFVEEVLKIALSDGFCIDSSHPHAVDFMNNKIIRLIRYR*
92 >lcl|XP_589215.1|Plus1complement(975715..977409) NW_001493444 zinc finger protein 502-like ZNF648 __SEG__ Chr16 {Bos taurus} MAQGDPQDGWGDASPLCSLTGEAYDPGMLSVNLESEDEAPGKAGDQGATGDPDQQARPRGSSQVTEDNPDLLWKHPACRKEEKFSDSFSAAGVGKKPMAPLRKKASWERD
ASKITPTEASPRASVTPSALPRGLARKWFGETQPPRASLPAGDEADSRANLDATLGVPSNFLGSARYFRAQKDGDKSPDNSSAGACVPKAGGSWDLSTQETHTPAQESAT
QACLAVEEALAKARKGSKDPNPAGSGEGRQGEARPYKCLRGGRAVQKSLGAKPYACELCGKAYSHRATLQQHQRLHTGERPYQCPFCDKTYTWSSDHRKHIRTHTGEKPY
PCPDCGKAFVRSSDLRKHQRNMHSNDKPFPCAECGLTFNKPLSLLRHQRTHLGEKPFRCPTCDREFAVASRMMEHQRVHSGERPFPCPTCGKCFTKSSNLLEHQTLHTGQ
RPFKCADCGVAFAQPSRLARHQRIHTGERPFPCAQCGQAFARSSTLKRHQQIHSGEKGFLCAECGRAFRVASELAQHIRVHNGERPYQCADCGQAFTRSNHLRRHQAKHH
SCKKEPTTPSSDDE*
93 >lcl|XP_589411.3|Plus11739884..1740444 NW_001493242 putative GTP-binding protein RAY-like RABL4 __SEG__ Chr14 {Bos taurus} MVKLAAKCILAGDPTVGKTALAQLFRSDGAHFQKNYTLTTGVDLVVKTVAVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEQSFTNCSKWLEKARSQ
IPGTTLPGVLVGNKTDLAGRRVVDVAQAQAWALGQGLECFETSVKEMENYEAPFHYLAKQFHHLYREKLEVFQVLV*
94 >lcl|XP_589840.1|Plus11452752..1453711 NW_001494814 gp50/Trop-2-like TACSTD2 __SEG__ Chr3 {Bos taurus} MARGPGLALLSPWLLMLAAVIGHAAAQNQCVCPTNKMTVCDERDPSGRCQCRVLGSNQAVNCSTLTSKCLLLKARMSASHSGRALVRPSEHAIVDNDGLYDPDCDQQGRF
KARQCNQTSVCWCVNSVGVRRTDKGDLSLKCDEVVRTYHILIDLRHRPDAPAFNHSDLDAELRQLFQQRYLLQPKFVSAVHYEHPTIQIELRQNSSQKVAGEVDIGDAAY
YFERDVKGESLFLGPRDLNLRVGGQPLVLEQMLIYYLDEKPPQFSMKRLTSGLIAVVVVVVVAVVAGAAVLVITNRRKSGKYKKVEIKELGEIRQKPSL*
95 >lcl|XP_590961.2|Plus1225635..226273 NW_001492795 hypothetical protein LOC513300 __SEG__ Chr10 {Bos taurus} MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHVIGFAFEYFANSQFHDCSDHVCFISPEVTQFIKCTGNPAEIAMFLEPLDLPNKRVIFLAINDNSNHTAGGTHWSLLVYLQ
DKNGFFHYDSYGSSNSFHAKQVAEKLEAFLGRKGNKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQPQSLLQLLTPTYITKKREEWKDLIARLAKN*
96 >lcl|XP_591307.2|Plus1complement(502900..503742) NW_001508798 neuroblastoma RAS viral (v-ras) oncogene homolog ERAS __SEG__ ChrX {Bos taurus} MTPGCPPVPKWSHLIPQPPTPPIVFLLFPSAGPAVHISSLSCPLGAMAQPTKPDMFDLGLGTWSPRSREQSHRAWGSPSKGVGKKLPEYKAVVVGASGVGKSALTIQLNN
QCFVEDHDPTIQDSYWKEMALDHGGCILNVLDTAGQATHQALRDQCVAIGDGVLGVFALDDPSSLAQLQQMRATWGPHHTQPLVLVGNKCDLVTTTGDARAAAAALAKSW
GAPFVETSAKTRQGVVEAFSLLIQEIQRVREAMAKEATTGPGGDKGRHQKAMCHCGCSVA*
97 >lcl|XP_591677.2|Plus12581583..2583655 NW_001493688 intramembrane protease 5-like LOC513917 __SEG__ Chr19 {Bos taurus} MACLGFLLFFLLLFLLASTTAQGEYGVVHVVSDNWSKDYCILFRSDYVTLPRDLQHAPLLPLHDGTGASWCPGQDSSHQAHPDGSASQRPLHRTTAMVMRGNCSFYDKGW
LAQGRGAHGLLIVSRVSDQQCSDITPAAQNPHKPLPDLTIPVAVLRYTDMLDILSHTHGGNRVHVALYAPPEPILDYNMVVIFLLAVGTVAVGGYWAGVTEADRLQRRRA
RGGGGPGGHPPQRALAARRGPEEDDEDSPVDFTPAMTGAVVTMSCSIMLLLYFFYDCFVYIMIAIFGLGAGTGLYSCLVPVVRHLPVWQDQWLLPGRRACLQLPLLLLAG
LCLVVTVLWVAYRNEDRWAWLLQDTLGVAYCLFVLRRMRLPTLKSCASFLLALLVFDVFFVFITPLLTRTGESIMVGVASGPADSLSHERLPMVLKVPRLSFSALTLCDQ
PFSILGFGDIVVPGFLVAYCHRFDVQIHSRQVYFVACTAAYAVGLLVTFFAMALMQMGQPALLYLVSSTLLTSLAVAACRQELTLFWTGQVRGKALTRPVPGLCGAPSVG
SEQKQEHAADIHRAFELEGATISTLARDLDSSLGEGTAETVTISEDGAASPEGHSDSSEGWSDANLEPDDLSSTPSGVSEELLPLMPMAMLIPLRPPPSELGHIQAQAQA
QAHEANLSWTGFHKRKGLKVKKSMLTQDPL*
98 >lcl|XP_596267.3|Plus1695072..696580 NW_001492996 zinc finger and BTB domain containing 37 ZBTB34 __SEG__ Chr11 {Bos taurus} MDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLSISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQ
MQCVIDKCTQILESIHSKISVGDVDSVTVGAEETPESRNGVKDSSFFANPVEISPPYCSQVRQPTTSSDLRMETTPSKALRSSRLQEEGHSDRGSSGSVSEYEIQIEGDH
EQGDLLGRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYCQAASQPAGGVSEAFGSLSNSSPSRSMLSCFRGGRARQKRALSV
HLHSDLQGLVQGSDSEAVVSNPGFESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIRGHTDDKPFRCEICGKCFP
FQGTLNQHLRKNHPGVAEVRSRMESPERTDVYAEQKLENDASASEMALDSRMEIHTVSDAPD*
99 >lcl|XP_597829.2|Plus1819004..820965 NW_001508835 kelch-like 34 KLHL34 __SEG__ ChrX {Bos taurus} MSYFLSYCKAHGGSLLTGYQALRAEGFLCDVTLEAEGSEFPAHRSLLACSSDYFRALFKSHTRESQASVIHLHVPSAAGLQRLLDFIYTAWLPLSMDTVEDTLEAASYLQ
VTEALGLCGRYLERQLALENCCFAANVAARFGLAHTLSAAERCIVTHLRELLARGAGPAGLLELNPASLRAVLGAPDVARVPEARLLGLALAWLRQEPEAERLAHCTQLL
ERVRFGLVPADVLRRVYSGSGLTLPARVKGLIIQALNYHTSPSRQPLMQGEQTSVRSPQTRILLVGGRRGREVVTEEVVVPPRAARGRGAAPEPEPEEEEGEEEEEEEEQ
VEEEEWELTQDVVAFDVYNHRWRSLTRLPAQLLGHSVCVAGNFLFVLGGESPSGGACSPPADGPMAVVAQVHRYDPRFHVWTTVPPMREARAHFWCGAVGEGLLAVGGLG
AGGQALASVEMYDLRRDRWTAAGALPRALHGHAGAVGDRGVVYISGGKAGRGDGGASSLRDVFSLAPGEQTWSKRAPMGTARFGHHMAALRGAVFAFLGRYEPFSEIERY
DPGTDQWTRLRPLPYDRFCYGLALVEETVLLLGGLKWRDSRQVPTRNVVGYDLDLDRWEDIGCALPWAWSGLQCAVLQLAEGGDEQREGEPGETPDFVLGLMG*
100 >lcl|XP_597854.4|Plus1complement(172721..173983) NW_001495359 hypothetical protein C2CD4C __SEG__ Chr7 {Bos taurus} MKKTNMWFLERFRGSGENGAAGGEGGDKAAKGPLYSNVLTPDKIPDFFIPPKLPAGPAEPEAQAELGPSTSEQNLASAAPRRAPRSPRLPAKLAAESKSLLKAATRHVIQ
IESAEDWPAEETATNADPQAQGAMSLPSVPKAQTSYGFATLAESPHTRRKESLFHSEHGALAQVGSPGTRRRRGGVKANGGDGGPREAGGTLMSPGRCVSGGESDTGSSA
ESSPFGSPLLSRSVSLLKGFAQDSQAKVSQLKHSVGRHGSLSADDSTPDTSPGARRRLHRRATPEPGRESGPASRAEHAVRMGPRGSVHLLAEYEAAQARLRVRLLAAEG
LYDRMCDARSINCCVGLCLVPGKLQKQRSTIVKNSRHPVFNEDFFFDGLGPASVRKLALRIKVVNKGSSLKRDTLLGEKELPLTSLLPFL*
101 >lcl|XP_605550.1|Plus1616994..618370 NW_001492789 kelch-like 12-like LOC527160 __SEG__ Chr10 {Bos taurus} MPQGPETLVQVWVGSQLFQADRALLVEHCGFFRGLFRSGMREARAAEVHLGALSPDGFHTTLRVLRGERPALAAADELLQAVECAAFLQAPALARFLEHSLTSENCALLC
DAAAAFGLHDVFHSAALFIRDGARELAAELALPEARTYVAELRPSSYVAVSTHAPAPGFLEDPSRTMCYLDEEEDTWRTLAALPLEASTLLAGVATLGNKLYIVGGVRGP
NKEVVDLGFCYDPDGGTWREFPSPHQPRYDTALAGFEGHLYAIGGEFQRTAMSSVERYDPASGCWSFMADLPQPAAGVPCAHARGRLFVCLWQPAETTAVVEYAVRADEW
LPVAELRRPQSYGHCMVAHRDSLYVVRNGPKDDFLHCAIDCLNLATGQWTALPGQFVNSKGALFTAVVRGDTVYTVNRVFTLLYAIEGGSWRLLREKAGFPRPGSLQTFL
LRLPPGAQGPVASTTPEL*
102 >lcl|XP_606234.3|Plus13516006..3516950 NW_001495372 potassium channel tetramerisation domain containing 16 KCTD16 __SEG__ Chr7 {Bos taurus} MALSGNCSRYYSREQGAAVPNSFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLFRYILDYLRDRQVVLPDHFPERGRLKREA
EYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTMGREGQADAKFRRVPRILVCGRISLAKEVFGETLNESRDPDRAPE
RYTSRFYLKFRHLERAFDMLSECGFHMVACNSSVTASFVNQYTDDKIWSSYTEYVFYRKYRAFLLFFMCMDLFNRYICIYGLHVQSTSKERVVV*
103 >lcl|XP_606986.2|Plus1392759..393523 NW_001501755 F-box protein 27 LOC528560 __SEG__ Chr26 {Bos taurus} MGASTSWGLLSRVPAPHREPQEAPSLNQLPIEMLRNVLSYLPPSTLLWHCRPVCQHWRDLVDGWDLWRSILPWKHPDLWPVILICLPPADNPRPCILGRFCELRPIGRKL
TANTPSKDLWNCMMLNGSNGSEEEEDLGVRLKTSGETSYSLAYRCWYKGEISDMEEEGLCRELLDSGNIWISVCHCWTEQQGSNRMYQVVFKLLDANYAISHYFFHKRFS
IRPRTGSFSFRIMHAFTSIKKGVHFVLFDHSVKG*
104 >lcl|XP_607200.3|Plus1complement(1995455..1996144) NW_001495218 alpha-N-acetyltransferase 1B NAA11 __SEG__ Chr6 {Bos taurus} MNIRNARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLH
VRKSNRAALHLYSNTLNFQISEVEPRYYADGEDAYAMKRDLSQMADELRRQLQLKKGGYVVLGSRENQETQGSTLPGSKMACQEKNPATDGSGSDSKEPSESTESPDAQD
SSEDSNSTS*
105 >lcl|XP_608636.3|Plus1complement(2066076..2068466) NW_001494707 Kelch domain-containing protein 7A-like KLHDC7A __SEG__ Chr2 {Bos taurus} MLPRGGGAEAQDWHLDMQLTGQLVLSAAALLLLTAAYKLYKSRPAQALPRGADAKAEAEAEGGGSGQPAAQEAVPGAPWWDLRRRRGSKGTTGPPGCSWERTEASRVPAT
GASSATSEAGEAGKAGRKHAGEEHAGQCPDSDLPAPRCGDQEAGTAVDGKPELPHRPHQCSEPPSPPAGLPAMESGRVGGELTPRQDSGPPKHPGSGEQESPHEGEVAHR
EGQCDMNNTWVFTHASGVHREEAAALQAASDLGLALRQREGASDASYTFSSMARVRVEENFIPEKVEGIRPRLKGKVYDYHVEYTSQATSRSRLAPGTAASAGAPAPESV
SGPLGTRIASGRPAGDGEGRQETAASPGSDPSGSTRGFSRKESLLQILENPEFQLQLDSFGDAAPSCPDQRAAPTRPTSQDSPESSSAGSRGKPHVHSVAGTSFFHPPLS
PGSALEVHLDLGNCYQALAFAKRKKLEPLKEAAYKVMRDNYLQVLRSPDIYGRLSGAERELVLQRRLRGREHLVVADVCPQDGSGRLCCYDDERDAWRPLARLPPEAVSR
GCAICSLFNYLFLVSGCQGSGLQPSNRVFCYNPLTDIWSEVCPLNQARPHCRLVALDGQLYAVGGECLNTVERYDPRLDRWTFAPPLPKDTFALAHTAAASGGELFVTGG
SLRYLLLRFSVREQRWRAAPTGGGRDRTAEMVAVRGFLYRFDLNRSLGISVYRCSASARLWYECATYRTPYPEAFQCAVVDELVYCVGRRRTLRFLADSISPRFVPEMRQ
AFPSPQGTLLPTVLTLPGPDVPQTRV*
106 >lcl|XP_609522.3|Plus1complement(216491..217066) NW_001508776 ras homolog gene family, member G-like LOC531038 __SEG__ ChrX {Bos taurus} MQTIKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQTSVDGQIVILNLWDTAGQEEYDRLRTLSYPQTNIFVICFSIGNPSSYANVRHKWYPEVSHHCPNVPV
LLVGTKRDLRSDLETVKKLKEQSLVPTSPQQGTSLAKQVGAVKYLECSALMHDGVREVFLEAIRAVLYPATKKNTKKCVLL*
107 >lcl|XP_869151.1|Plus1222806..223399 NW_001508802 high mobility group box 3-like LOC613370 __SEG__ ChrX {Bos taurus} MAKGDPEKPKGKMSAHAFFVQMCRKKHKKTPKVPVNFAEFSKKCSERWKTMSGKEKSTFDEMAKADKVHYNQEMKDYGSAKGGKKDPNAPKRPPSGFFLFFSEFCSEIKS
TNPGISIGDVAKKLGEMWNNLSDSKKQLYVNKDAKLKKYEKDVADYKGEFDGTKGPAKVVQKKVEEEEDKEEEDELKKKTVDLSVSL*
108 >lcl|XP_870294.3|Plus12561855..2563996 NW_001492860 zinc finger and BTB domain containing 1 isoform 2 ZBTB1 __SEG__ Chr10 {Bos taurus} MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVP
DCLEDIQDADCSSSKCSSSASSKQNSKMIFGVRMYEDTVARNGSEANRWCAEPSSTVNTPHNREPDEESLQLGNFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDS
CGFGFSCEKLLDEHVLTCTNRHSYQNTRSYHRLVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTGSRKSSTVESELASEEKSRAAERKRIIIKME
PEDIPTDELKDFNIIKVTDKDCNESTDNDELEDEAEEPFYRYYVEEDVSIKKSGRKTLKPRMSINADERGGLENMRPPNNSSPVQEDTENASCELCGLTITEEDLSSHYL
AKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNAEEKMDMEENPDEQSEIRDMFVEMLDDFRDNHFQINSIQKKQLFKHSACPFRCPNCGQRFETENLVV
EHMSSCLDQDVFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSAG
ETICQVCFQIFPNNEQLEQHMDIHLYTCGICGAKFNLRKDMRSHYNAKHLKRT*
109 >lcl|XP_872837.1|Plus1complement(48429..51113) NW_001494124 RNA binding motif protein 15B RBM15B __SEG__ Chr22 {Bos taurus} MKRQSERDSSPSGRGSSSSAKRPREREREAEAGGRRAAHKASGGAKHPVPTRARDKPRGSGGSGGGHRDGRGAGDANHRASSGRSSGSGAGGGGRGGKASGDPGASGASP
RASPLPPPPPPPGAEPTGPGSSAAAPEYKTLLISSLSPALPAEHLEDRLFHQFKRFGEISLRLSHTPELGRVAYVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLR
GGGGGGGSSRRSSSSSAAASTPPPGPPAPADPLGYLPLHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAAVGLSRERALDYYGLYDDRGRPYGYPAVCEED
LMPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLDMAHRAKVGMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAR
EFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEETRYPQQYQPSPLPVHYELLPDGYTRHRNLDADLRVRDRTPPHLLYSDRERTF
LEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGGDGDRGLPKAWEDRRKRRSLSSDRGRATHSPYEERSRTKGGGQPADRGSDRTPERSRKENHSSEGTKESGSNSLSN
SRHGAEERSHHHHHEAPDSSHGKKTRESERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIA
QRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQATPSGPGSEGMPTVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDSTGMLYAFPPCDFSQQYLQSALRTLGKL
EEEHMVIVIVRDTA*
110 >lcl|XP_873435.1|Plus1391540..392091 NW_001493616 PERP, TP53 apoptosis effector-like PERP __SEG__ Chr18 {Bos taurus} MLRCGLACERCRWILPLLLLSAIVFDIIALAGRGWLQSSDDSQTSSLWWHCLLEVCDSLMTYAWGRAAAAMLLCGFIILVICFILSFFALCGPQMLAFLRVIRGLLALAA
VFQIISLVIYPVKYTQTFNLHLNPAVTYIYNWAYGFGWAATIILIGCAFFCCLPNYEDDLLGNAKPRYFYTSA*
111 >lcl|XP_873531.1|Plus1complement(461047..462027) NW_001493062 potassium channel tetramerisation domain containing 12 KCTD12 __SEG__ Chr12 {Bos taurus} MALADSTRGLPNGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERS
RLQREAEYFELPELVRRLGAPQQPGPGPPPPHSRRGVQKEGSLGDDLLPLGSAESEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSYT
IGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFAGSTDQSEDKIWTSYTEYVFCRE*
112 >lcl|XP_873644.1|Plus1complement(195047..195424) NW_001493317 splicing factor 3B, 14 kDa subunit LOC616520 __SEG__ Chr15 {Bos taurus} MAMQAAKRANIRLPPEVNQILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVIYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQL
KLLKEKYGINTDPPK*
113 >lcl|XP_875655.1|Plus13995299..3995862 NW_001493616 Phosphatidylethanolamine-binding protein 1-like LOC618233 __SEG__ Chr18 {Bos taurus} MPVDLSKWPGPLSLQEMDERPQHPLQVEYGGAEIDELGKVLTPTQVKNWPTSTTWDGLDLGKLYTLVLTDPDAPSGKDPKYREWHHFLVVNMKGNNISSGTVLSDYVGSG
PPKGTGLHCYVWLVYEQKGPLKCDEPILSNRSGDHRGKFKVASFRKKYELGAPVAGTCYQAKWDDYVPKLYEQLSGK*
114 >lcl|XP_881008.3|Plus11624897..1627851 NW_001493257 RNA binding motif protein 12-like isoform 4 RBM12B __SEG__ Chr14 {Bos taurus} MAVVIRLLGLPFIAGPVDIRHFFTGLTIPDGGVHIIGGEIGEAFIIFATDEDARRAVSRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRMGRERPGSGASGVGSLSNFV
EAIKEEGSNSGYGSPINQDAGFHTNGTGHGDLRPRKTRPLTAENPYLFLRGLPYLVNEDDVRVFFSGLCVDGVIFLKHHDGRNNGDAIVKFASCIDASGGLKCHRSFMGS
RFIEVMQGSEKQWIDFGGNLIKEGDISMRTEEHTPPRGINDRHFRKRSHSKSPRRTCSRSPLGFYVHLKNLSVSINKRDLRNFFRDTDLTNEQIRFLYKDERRTRYAFVM
FKTLKDYNTALGLHKTVLQYRPVYIDPVSREQMLKFIECYEKKRPASTEKERLGQVSQKHSQEGYSGQKLCIYIRNFPFDVTKVEVQKFFADFSLAEDDICLLYDDKGVG
LGEALVKFKSEEQAVKAERLNRRRFLGTEVLLRLISEAQMQEFGVNFSSMSSERMHDHSQSCDRDDHSHSFDSNDPPVYSGGPSENFRHQQEDLRQLDNFKHPQGDFRPP
ERRPPEDFRHSPEDFRRSPENFRRLEEEHFRRPPEEDFRRSREEDFRYPREEDWRRPPEEDFRRPPKEDFRRPQEEDWRHPPEGDLRRPPEEDWRRPPEEDFRRLPPGEW
RRQPEEDFRRPPEEDFRRPPEEDFWRPHQEDFRRSPEEDFRGSPEDFRRPPPEHFRRPPPEHFRRPPPDHFRRLPPEHFRRPPQEHFRRPPQEHFRRPSQEHFRRPPQEL
FRRPPQEHFRRPREEDFRHPQDEDFRGPPDEDFRHPSEEDFRSSQEEDFRSPSDEDFRRLPEEDLREAPEEDSRVPDRFRLPGEEFRSPPGFRSHRPFVNFGRPEGGKFD
FGKRNMGSFPEGRFMPDPKLNCNSGRVTPIKIMNLPFKANVNEILDFFHGYRIIPDSVSIQYNEQGLPTGEAIVAMINYNEAMAAIKDLNDRPVGPRKVKLILL*