SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor Q    

ID / Description / Sequence
1 >lcl|NP_112520.1|Plus15061870..5063369 NW_047803 cytochrome P450, family 8, subfamily B, polypeptide 1 Cyp8b1 __SEG__ Chr8 {Rattus norvegicus} MLWGSVLGALLMAVGCLCLSLLPRHRRPWEPPLDKGFVPWLGHTMAFRKNMFEFLKGMRAKHGDVFTLQLGGQYFTFVMDPLSFGPIIKSTQKVLDFVTYARELVFKVFG
YQSMDEDHQMLHIASTKHLMGQGLEDLNRAMLDSLSLVMLGPKGRSLGARSWCEDGLFHFCYSILFKAGFLSLFGCTKDKEQDLDEADELFRKFRRFDLLFPRFVYSLLG
PREWVEVSQLQRLFHQRLSVEQNLEKDGISNWLGFMLRFLRERGMASSMQDKFNFMMLWASQGNTGPTCFWALLFLLKHQDAMKAVREEATRVLGEARLEAETSFAFTLS
ALKCTPVLDSVMEETLRLCATPTLLRVVQEDYVLKMASGQEYQIRRGDKVALFPYLSVHMDPDIHPEPTTFKYNRFLNPDGTRKVDFYKSGKKIHHYNMPWGSGVSICPG
RFFALSEMKTFVLLMVMYFDFELVDPDVPVPPIDPRRWGFGTSQPSHEVRFRYRLKPMQ*
2 >lcl|XP_002730033.1|Plus1complement(26773..26952) NW_047805 rCG53651-like LOC100362704 __SEG__ Chr8 {Rattus norvegicus} KRICLGEGIARNELFLFFTTILQNFSVSSHLAPKDIDLTPKESGIAKIPPTYQICFSAR*