SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus Q    

ID / Description / Sequence
1 >lcl|NP_034142.3|Plus1complement(13009406..13010908) NT_039482 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase Cyp8b1 __SEG__ Chr9 {Mus musculus} MTLWCTVLGALLTVVGCLCLSLLLRHRRPWEPPLDKGFVPWLGHSMAFRKNMFEFLKGMRAKHGDVFTVQLGGQYFTFVMDPLSFGPIIKNTEKALDFQSYAKELVLKVF
GYQSVDGDHRMIHLASTKHLMGQGLEELNQAMLDSLSLVMLGPKGSSLGASSWCEDGLFHFCYRILFKAGFLSLFGYTKDKQQDLDEADELFRKFRRFDFLFPRFVYSLL
GPREWVEVSQLQRLFHQRLSVKQNLEKDGISCWLGYMLQFLREQGIASSMQDKFNFMMLWASQGNTGPTCFWVLLFLLKHQDAMKAVREEATRVMGKARLEAKKSFTFTP
SALKHTPVLDSVMEESLRLCATPTLLRVVQEDYVLKMASGQEYQIRRGDKVALFPYLSVHMDPDIHPEPTAFKYDRFLNPDGTRKVDFYKSGKKIHHYSMPWGSGVSKCP
GRFFALSEMKTFVLLMIMYFDFKLVDPDIPVPPIDPRRWGFGTSQPSHEVRFLYRLKPVQ*
2 >lcl|XP_001480523.1|Plus1complement(597426..597896) NT_166306 acyl carrier protein, mitochondrial-like Gm4459 __SEG__ Chr7 {Mus musculus} MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPEALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGL
DSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE*