SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul Q    

ID / Description / Sequence
1 >lcl|XP_001088376.1|Plus15016817..5017941 NW_001105681 alcohol dehydrogenase class-3 isoform 2 ADH5 __SEG__ Chr18 {Macaca mulatta} MANQVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGAEPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNHKTNL
CQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKVEPGSVCAVFGLGGVGLAVIMGCKVAGASRII
GVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECTGNVKVMRAALEACHKGWGISVVVGIAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPK
LVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKI*
2 >lcl|XP_001112404.1|Plus1complement(14207987..14208457) NW_001101663 acyl carrier protein, mitochondrial isoform 2 NDUFAB1 __SEG__ Chr15 {Macaca mulatta} MASRVLSAYVRRLPAAFAPLPRVPMLAVAQPLSTGLCSAGTQTRLGPLQPALRLAQVPGRVTQLCRQDSDMPPLTLEGIQDCVLYVLKLYDKIDPEKLSVDSHFMKDLGL
DGLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE*
3 >lcl|XP_001115039.1|Plus1<486..875 NW_001118636 acyl-CoA synthetase family member 4-like LOC720042 __SEG__ Chr5 {Macaca mulatta} VWQFCTSGPIFSSPCTSSSEQKIFFGSHDCFVYCCNMKGHLQWKFETTSRVYATPFAFHNCNGSNEMLLAAASTDGKLWILESQSGQLQSVYELPGEVFSSPVVLESMLI
IGCRDNYVYCLDLLGGNKK*