SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom Q    

ID / Description / Sequence
1 >lcl|XP_001364127.1|Plus1complement(11987346..11988176) NW_001581975 carbonyl reductase [NADPH] 1-like LOC100015316 __SEG__ Chr6 {Monodelphis domestica} MSSSSRVAVVTGSNKGIGFAIVRNLCQKSSGDVILTSRDTTRGQAATKKLQEEGLNLIFHQLDIDDPQSIRTLRDFLKECYGGVDVLVNNVGIAFKVADTTPFPIQAEVT
MKTNFFGTKAVSAELLPLVKPRGRVVNVSSMVSLRSLKSCSPELQQKFRSDTITEEELVRLMEKFVEDTKKGVHQKEGWPNSAYGVTKIGVTVLSIHARQLNEQRKGDKI
LLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDATEPHGQFVMEKRVEKW*
2 >lcl|XP_001377104.2|Plus145000091..45001617 NW_001581981 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase-like LOC100026525 __SEG__ Chr6 {Monodelphis domestica} MALWASVLIVLVAIVLIGLYKLGALRQRKAREPPLDKGPIPWLGYSKEFSKDASIFLKKMQERHGDIFTVQLCGRYVTFVTDPFTYDAILKESKDKLGFSNLVSEKVIKI
FDIQYEEGHQKISSNIHTKHLSASSLVVITQAVMDNLQTLLLEPDGGIRPASQEWKQDGLLEYCYSVIFRAGYLALFGSFPTSGKTGRIQDLLHSQKVFQEFRKFDRLFP
RAFYSILHPKEKQEMKRLRHFFWDILSSQQILEKDNVSSWIHSIQQEMIENGVSDKGQSQNNLVLLWASQGSTTGVNFWTLFFLLKNPEALKAVREEAEGILRKMGKEKR
PGGVPINFDYNMLKQTPVLDSVMEETLRLVVAPFLARSVMQDMTLKMDDGREYALRKGDEVCVFPYLFLHMDPEIHSDPTTFKYDRFLTLDGSQKVVFYKQGRRIKSHML
PWGAGTTLCPGRFLALNQIKMFIFLMVTQYDMELVDQEAGIPPINVKRWGMGPLQPMYDVQFRYRLRF*
3 >lcl|XP_001377118.2|Plus145025925..45027451 NW_001581981 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase CYP8B __SEG__ Chr6 {Monodelphis domestica} MALWVFVFIILVSSVLVVLYALGVLRQRRAREPPLDKGPIPWFGYTWHLSKDASSFLKKMHRRYGNIFTILLGGKYVTFVTDPLSFDAILKENRSKLDFSNFASQLVFKI
FEFQGPKQYQKVLKSHSTKYLMGSSLAVMTQAMMDNLQVLLLELDADMKPGLQEWKQDGLLEHCYNIVFRAGYLALFGSLPTSGKSGHIQDLLRSQKVFEEFRKFDRLFP
RAFLSALLPNEKQEMKRLRRFFWDILAPQKILEKDNVSPWIYFSQQQLADSGVSDIGQSQNNLILLWASQGNTGIVSFWALLFLLKNPGALKAVREEAEGILRKMGKERR
PGGVPIQVEYSMLQQTPVLDSVMEETLRLVVAPFLTRSVMQDMILKMDDGREYALRKGDEVCVFPYLFLHMDPEIYPDPTTFKYDRFLNLDGSQKVDFYKQGRRIKSYML
PWGAGPSLCPGRFFALNEMKMFVFLMVTQYDIELVDQEVEIPPINVKRWGIGAMQPIYDVQFRYRMRF*