SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab Q    

ID / Description / Sequence
1 >lcl|XP_001501478.2|Plus119947952..19949457 NW_001867381 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase-like LOC100054970 __SEG__ Chr16 {Equus caballus} MVLWVPVLGVLLVAIVGYLCVLGLLRQRRPQEPPLDKGSIPWLGHAVAFRKNMFEFLKHMRAKHGDVFTVQLGGQYFTFVMDPLSFGPILKDAQRKLDFVEYAEKLVLKV
FGYHSVQGDHRMIHSASTKHLMGDGLEDLNKVMLDSLSLVILGPTGRSPDASCWREDGLFHFCYDILFKAGYLSLFGYTKDKEQDLLQAEELFIHFRKFDCLFPRFVYSL
LWPREWLEVGRLQRLFHKTLSVKHNLEKDGISNWISYMLQFLREQEVAPAMQDKFNFMMLWASQGNTGPTSFWALLFLLKHPEAMRAVRKEATRVLGEARLEARQSFNFK
VSALHHTPVLDSVMEETLRLGAAPTLLRVVHGDHTLKMASGQEYRLRSGDIVALFPYLSVHMDPDIHPDPTAFKYDRFLNPNGSRKVAFYKAGKKIHHYTMPWGSGVSIC
PGRFLALSEMKLFILLMVTHFDLELVDPDTPVPPVDPKRWGFGTTQPSHDVRFRYRLQPTE*