SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam Q    

ID / Description / Sequence
1 >lcl|XP_532181.2|Plus1complement(23594952..23596076) NW_876254 alcohol dehydrogenase class-3 isoform 1 ADH5 __SEG__ Chr12 {Canis lupus familiaris} MANQVIKCKAAVAWEAGKPLSIEEVEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGSFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNL
CQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAALNTAKVEPGSTCAVFGLGGVGLATIMGCKVAGASRII
GVDINKDKFSRAKEFGASECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVIVGVAASGEEIATRPFQLVTGRVWKGTAFGGWKSVESVPK
LVSEYMSRKIKVDEFVTHSLSFDQINEAFDLLHAGKSIRTVVKL*
2 >lcl|XP_542738.1|Plus1complement(12008983..12010488) NW_876276 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase-like LOC485619 __SEG__ Chr23 {Canis lupus familiaris} MVFWGLVLGALLVVTTGCLYLLGVLRQRRPQEPPLDKGSIPWLGHAMAFRKNMFEFLKHMWAKHGDVFTVQLGGQYFTFVMDPLSFGPILKDAQRKLDFVKYAEKLVLKV
FGYHSGQGDYRMIHSASTKYLMGDGLEDLNKTMLDSLSLVMLGPTGQSLDSSCWHEDGLFHFCYNVLFKAGYLSLFGYTKDQEQDLRQAEELFVQFRKFDRLFPRFVYSL
LGPREWREVGRLQRLFHKALSVKRNLEKNGISRWISYMLQYLRERGVAPAMQDKFNFMMLWASQGNTGPTSFWALLFLLKHPEALRAVREEATQVLGEARLKARQSFDFK
VSTLHHTPVLDSVMEETLRLGAAPTLLRVVHNDHILKMASGQEYLLRSGDIVALFPYLSVHMDPDIHPEPTTFKYDRFLNPNGSRKVDFYKAGKKIHHYTMPWGSGVSIC
PGRFLATNEMKLFVLLMVTYFDLELVDPNTPVPPVDPQRWGFGTTQPSHEVRFRYRLRPTS*