SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau Q    

ID / Description / Sequence
1 >lcl|XP_002702257.1|Plus11393784..1393993 NW_001493678 hCG1639864-like LOC100336124 __SEG__ Chr19 {Bos taurus} MVTVGNSVGFFLRPYNFFDEDSSINSADSIYFREDQDAGSCEVNSLACLPQVAACAPDLPAFSHGGFSS*
2 >lcl|XP_002702258.1|Plus11442800..1443009 NW_001493678 hCG1639864-like LOC100336135 __SEG__ Chr19 {Bos taurus} MVTVGNSVGFFLRPYNFFDEDSSINSADSIYFREDQDAGSCEVNSLACLPQVAACAPDLPAFSHGGFSS*