SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr P    

ID / Description / Sequence
1 >lcl|NP_001072156.1|Plus1complement(80061..80792) NW_003535342 extracellular superoxide dismutase LOC780439 __SEG__ Chr8 {Sus scrofa} MLTLLCAYLLLAPGASDALTHVDVERPGSHMEEQIRDMQAKVTEIWQELTQQRAAGGGQEAALHATCSMQPSVLLDAAQPQVTGLVLFRQLRPGALLEAFFHLKGFPAEP
NSTSRAIHVHQFGDLSQGCDSTGPHYNPLDVPHPQHPGDFGNFAVRDGQIWRYRSSPGASLFGPHSIADRAVVVHVGEDDMGRGATRPAWRTATPAAAWHAAWWPCAAPG
PGRPRRRSTPIT*SGGAQASARPA
2 >lcl|NP_999384.1|Plus135091..35390 NW_003536258 calcium-activated potassium channel subunit alpha-1 KCNMA1 __SEG__ Chr14 {Sus scrofa} MSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSVHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTK
3 >lcl|XP_001924064.2|Plus1770866..772632 NW_003534689 potassium voltage-gated channel subfamily A member 3 KCNA3 __SEG__ Chr4 {Sus scrofa} MDEHLSLLRSPPPPPSTRHRAHPPQHPASRGGGGGGGGGGGGDAHTLVNPGYAEPAAGPELPPDMTVVPGDHLLEPEAADGGGDPPQGGCGGGGGCDRYEPLPPALPAAG
EQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREE
ERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKYYTASPSQELFEGGSNSTSGAPAGNSSFSDPFFVVETLCIIWFSFELLVRFFAC
PSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSG
FSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGM
NHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV*
4 >lcl|XP_001928447.1|Plus1307632..308759 NW_003301219 ATP-sensitive inward rectifier potassium channel 15 KCNJ15 __SEG__ Chr13 {Sus scrofa} MDAVHVGMASAPLVKHAAGAGLRTRRPRVMSKSGHSNVRIDKVDGIFLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVIYYGIAFIHGDLEHGEDTSSPTPCIMK
VDSLTGAFLFSLESQTTIGYGVRFITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTH
VTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKTGKYVADFSQF
EQIRKSPDCTFYCADSEKQKLEEKYRQEDQRERELRTLLLQQSNV*
5 >lcl|XP_001928955.1|Plus1complement(1073009..1074442) NW_003534614 potassium voltage-gated channel subfamily S member 2-like LOC100152757 __SEG__ Chr4 {Sus scrofa} MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGI
NEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGT
PGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVG
LLLLYLSVGISIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVP
SVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLH*
6 >lcl|XP_003121924.1|Plus132438..33064 NW_003534092 tumor suppressor candidate gene 1 protein-like LOC100513000 __SEG__ Chr1 {Sus scrofa} MWRMRGGATRRGTCGSGGAGDSRGQGRPGRVCGGGGGDGSVGWRGRAGGARQQLEERFADLAASHLEAIRARDERDRQNARLREENARLRLENRRLKRENRSLFRQALRL
PSEDGDGASGEVTRATLAPEEPGTDRRARGGGPEDEPGSPRALRARLEKLEAMYRRALLQLHLEQRESRPHGDKEEPSLLKPDSGLQSPEPQPSEPWL*
7 >lcl|XP_003122345.2|Plus1complement(<12925..13569) NW_003534188 potassium voltage-gated channel subfamily G member 2-like LOC100523354 __SEG__ Chr1 {Sus scrofa} MALLPGHAEPRGPEPLGGGGARARHVIINVGGCRVRLAWAALARCPLARLERLRACRGHDELLRVCDDYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGPCALAFRD
ELAYWGIDEAHLERCCLRRLRRREEEAAEARAGPAGRMAPGSPGSALGPGGRLARGRRRLRDVVDNPHSGPAGKLFACVSVTFVAVTAVGLCLSTMPDIRAEEER
8 >lcl|XP_003122945.1|Plus1201619..203583 NW_003534240 potassium voltage-gated channel subfamily A member 4 LOC100037947 __SEG__ Chr2 {Sus scrofa} MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGGTHHHHQSRGACTSHDPQSSRGSRRRRRQRPEKKKVHHRQSSFPHCTDLMP
SGSEEKILRDLSEEDEDEDEDEEEEEEGRFYYSEDDRGDECSYTDLLPQDDGGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEY
FFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETL
PEFRDDRDLIMALSAGGHSGLLNDTSAPHPETSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQQGGGNGQQQQAM
SFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAG
VLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEKCQGKGDDSETDKNNCSNAKAVETDV*
9 >lcl|XP_003122996.1|Plus1239859..241025 NW_003534251 ATP-sensitive inward rectifier potassium channel 11 KCNJ11 __SEG__ Chr2 {Sus scrofa} MLSRKGIIPEEYVLTRLAEDPTEPRYRARERRARFVSKNGNCNVAHKNIREQGRFLQDVFTTLVDLKWPYTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGASVPC
VTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIAVRHGRLCFMLRVGDLRKSMIISATIHMQVV
RKTTSPEGEVVPLHQVDIPMENGVGGNNIFLVAPLIIYHIIDAKSPLYDLAPCDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYTVDY
SKFGNTIKVPTPLCSARQLDEDPSLLDVLTLTRGPLRKRSMAVTKAKPKFSISPESLS*
10 >lcl|XP_003123914.1|Plus1146580..147308 NW_003534351 ferritin, mitochondrial-like LOC100524926 __SEG__ Chr2 {Sus scrofa} MLPSFLFLSKHISTSLVSLRSACLCFALPPRCLPGRPWGHQPAALSRPLAAVTYCRGPAGPSCAPSRVRQNFYADSEAAINRQINLELYASYVYLSMAYYFSRDDVALHN
FARYFLRQSREETEHAEKLMRLQNQRGGQICLQDIKKPDQDNWKSGLNAMECALLLEKNVNQSLLELHTLASDKGDPHLCDFLETHYLNEQVKSIKELGDHVHNLIKMGA
PDSGLAEYLFDKHTLGNENNQH*
11 >lcl|XP_003125903.1|Plus1931532..933067 NW_003534689 potassium voltage-gated channel subfamily A member 10 KCNA10 __SEG__ Chr4 {Sus scrofa} MHVCGWKEMEVALVNFDNSDELQEEPGYAAGFDPTTPKGRPGSSPFSNWKILINESTNHETAFSKLPGDCLDPPGPEPLVLNEGNQRVIINIAGLRFETQLRTLSQFPET
LLGDREKRMQFFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEMSFYELGSEAMDQFREDEGFLKDPETLLPSNDIHRQFWLLFEYPESSSAARGVAV
VSVLVVVISITIFCLETLPEFREDRELKVVRDPSRNTSQTVLSHTLFTDPFFMVESTCIMWFTLELVLRFVVCPSKPDFFRNIMNIIDIISIIPYFATLVTELVQETEPS
AQQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTL
CAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQIIPGEIDKILNSVGSRRGSTDSLSKTNSGCSAEKSRK*
12 >lcl|XP_003126071.1|Plus1426301..427644 NW_003534724 inward rectifier potassium channel 4-like isoform 1 LOC100523060 __SEG__ Chr5 {Sus scrofa} MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEAGPAGATTGSPAGGGGGGGAAP
AAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAH
VRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSH
YKVDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQATLPLDNIS
YRRESAI*
13 >lcl|XP_003128024.1|Plus1367857..368573 NW_003535108 LOW QUALITY PROTEIN: chloride intracellular channel protein 1 CLIC1 __SEG__ Chr6 {Sus scrofa} MPEKQLQVELFVKAGSDGAKIGTCSISQRLFMVLWIKGVTFNVITVDTKRWTETVQKLSPGGAAPFPVVWH*SAHRYQQD*GISGGSAMPSQVPQAGSSEP*IQHSWARH
ICSIFCLYQEFTPRPQ*QPGEGGPESPESLRQLLDIPTPRRSG*DQC*G*GHLSEEVLNGNELTLANCNLLPKLHIGQLGM*KVLGILHSRWVLQNASQSLHLGSICLHL
SR**GDQVGLRISGQGPQI
14 >lcl|XP_003130125.2|Plus1complement(813046..814164) NW_003300559 ATP-sensitive inward rectifier potassium channel 1 KCNJ1 __SEG__ Chr9 {Sus scrofa} MFKRVRKWFITRIWGHSRRRARLVSKDGRCNIEFGNVEAQSRLIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPPANHTPCVEHINGLT
SAFLFSLETQVTIGYGFRCVTEQCGTAIFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEG
ETIILDQININFVVDAGNENLFFISPLTIYHIIDHTSPFFHMAAETLPQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVE
VETPHCAMCLYNEKDARARMKRGYDNPNFILSEINETDDTKM*
15 >lcl|XP_003132253.1|Plus1473829..475241 NW_003301032 coiled-coil domain-containing protein 71 CCDC71 __SEG__ Chr13 {Sus scrofa} MSVVVQHVEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTANPPSQTKLQARAPMPAATSPPASAPRTPMQLS
AGQATLLPMPLSGRLAKASTPPLTKHATTNLLLNSLKQSSASHAQGAAVGFPTHLYPGVYPAMRLSVVLEALVPLKTPIPCLSAKHKAQSVQLSLADSPLKLRRGPGKSP
GNSQPKVPRKATSKGPKGLTQRGSRAGPRQGNGPQNKTYKATGSLSSPRMKGGCSLGTKIAQAKAARAQAKVARTQAKVAKARAKAKAAQIKAKAKAARARAKAKAKAVQ
AKAKAKAARARARAKSKAVRANAKAVQAKAKVARIQPRGRGRPKRSVQARTARKGQKRCPETVGQKRKRADEEKDLPPRKRTRLGPQSPKMWLGRGTAKLLRFQAIKVDR
RSSDDEVRQQAQQILHVNLSPIIQLQPLLP*
16 >lcl|XP_003134180.1|Plus1420941..421402 NW_003301580 iron-sulfur cluster assembly 1 homolog, mitochondrial-like LOC100513185 __SEG__ Chr16 {Sus scrofa} MLASLVWATVQSVSKRKLQPTWAALTMTPSANEIKQLLRDKPELVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFV
FNNPNLKGTWGCGESFNICLLRTTWAVDPRRAMESLGLIEEIM*
17 >lcl|XP_003135054.1|Plus1928124..928675 NW_003536772 ferritin heavy chain-like LOC100524231 __SEG__ ChrX {Sus scrofa} MLPTPPSQVRHNYHPECKAALNSLVTLELHASYVYQALAFNLDREDMALKPLARCFLHRSQEHTRRSQELMSLQNRRGGRLCFRDIRKPDLEAWGGGLRALQCALHLEKR
VHQSLLDLHRLATHKSNAQLCHFLKSRYLDQQVEFIKELGDHVTTLSQMGAPEVEMTEYLFDKLTLGNSDKKD*
18 >lcl|XP_003135585.1|Plus1complement(630458..631945) NW_003534808 potassium voltage-gated channel subfamily A member 1 KCNA1 __SEG__ Chr5 {Sus scrofa} MTVMSGENVDEASAAPGHPQDGSYPRPAEHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPL
DMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFTGTVHRLDNTTVIYNSNIFTDP
FFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI
FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSAPNLASDSD
LSRRSSSTISKSEYMEIEEDMNNSIAHFRQANIRTGNCTTANQNCVNKSKLLTDV*
19 >lcl|XP_003353293.1|Plus171547..71939 NW_003533937 potassium voltage-gated channel subfamily KQT member 5-like LOC100622497 __SEG__ Chr1 {Sus scrofa} MPRHHAGGEEGGAAGLWVRSGAAAAGGGRPGGGMKDVESGRARALLNSAAARGDGLLLLGTRAAALGGGGGLRESRRGKQGARMSLLGKPLSYSSGQSCRRNVKYRRVQN
YLYNVLERPRGWAFVYHAFV*
20 >lcl|XP_003355151.1|Plus1943695..944834 NW_003299865 ATP-sensitive inward rectifier potassium channel 10 KCNJ10 __SEG__ Chr4 {Sus scrofa} MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVV
QVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAAHNGKPCLMIRVANMRKSLLIGCQVTGKLLQT
HQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLF
DQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGGALSVRISNV*
21 >lcl|XP_003358985.1|Plus1complement(640946..643102) NW_003536138 sodium/myo-inositol cotransporter SLC5A3 __SEG__ Chr13 {Sus scrofa} MRAVLETADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMP
EYLSKRFGGHRIQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIVGALTLMIISMMEIGGFEEVKRRYMLA
SPNVTSILLTYNLSNTNSCNVHPKKDALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFADDIAC
INPEHCMQVCGSRAGCSNIAYPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLY
IQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFILGAVRLTLAFAYRAPECDQPDERPGFIKDIHYMYVATALFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKK
SLVVKESCSPKDEPYKMQEKSILRCSENSEAINQIIPNGKSEDSIKGIQPEDVNLLVTCKEEGNPVSSLGHSEAETPVDAYSNGQAALMGEKERKKETEDGSRYWKFIDW
FCGFKSKSLSKRSLRDLMEEEAVCLQMLEEPPQVKIILNIGLFAVCSLGIFMFVYFSL*
22 >lcl|XP_003360199.1|Plus1complement(331543..332661) NW_003536707 potassium voltage-gated channel subfamily D member 2 KCND2 __SEG__ Chr18 {Sus scrofa} MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLERYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHE
CISAYDEELAFFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTGESTLPTMTARQRVWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELP
CGERYAVAFFCLDTACVMIFTVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFS
LTMAIIIFATVMFYAEKGSSASKFTSIPAAFWYTIVTMTTLG*
23 >lcl|XP_003360304.1|Plus1complement(792330..792881) NW_003536772 ferritin heavy chain-like LOC100624737 __SEG__ ChrX {Sus scrofa} MLPTPPSQVRHNYHPECKAALNSLVTLELHASYVYQALAFNLDREDMALKPLARCFLHRSQEHTRRSQELMSLQNRRGGRLCFRDIRKPDLEAWGGGLRALQCALHLEKR
VHQSLLDLHRLATHKSNAQLCHFLKSRYLDQQVEFIKELGDHVTTLSQMGAPEVEMTEYLFDKLTLGNSDKKD*
24 >lcl|XP_003360308.1|Plus11209350..1209901 NW_003536772 ferritin heavy chain-like LOC100625618 __SEG__ ChrX {Sus scrofa} MLPTPPSQVRHNYHPECEAALNSLATLELHASYVYQALAFNFDREDMALKHLACFFLRRSQEHTRRAQELMSLQNRRGGRLCFHDIRKPDQDNWESGLQAMQCALHLEKH
VHQSLLDLHQLATHKNDAQLCHFLESHYLDQQVEFIKELGDHVTMLHRMGAPEDNTAEYLFDKLTLGDSHKKN*
25 >lcl|XP_003360559.1|Plus1762822..764255 NW_003301855 p3 protein-like LOC100622635 __SEG__ ChrX {Sus scrofa} MVSRRGRGSPLWWPGPGGGGGHTGPAGVLGAALLLASLPWGAQGTAGAHPSAALGRAVPLARGRYLSIGDGSVMEFEFPEESEGIIVISSQYPGRGNGTGPGPALQVTSL
DTEVLAIKNVSAITWGGGGGFVVSIHSGLPGLAPLYIQLVDPHEAPPKLIEERRDFRIKVSPAEDPPATLGAGLAHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLL
QSPQPMLLGLLGQFLVMPFYAFLMAKVFMLPKALALGLILTCSSPGGGGSYLFSLLLGGDVTLAISMTFISTVAATGFLPLSSAVYSRLLSIHETLHVPISKILGTLLFI
AIPIAAGVVIKSKLPKFSQLLLQVIKPFSFVLLLGGLFLAYRMGVFILAGVRLPIVLVGLTVPLVGLLVGYCLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRL
QADYASQAPFIVALSGTSEMLALVIGHFIYSSVCTVP*