SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor P    

ID / Description / Sequence
1 >lcl|NP_001020451.1|Plus122724035..22725339 NW_047623 sodium/bile acid cotransporter 5 precursor Slc10a5 __SEG__ Chr2 {Rattus norvegicus} MSGKLFIILLLLVTPGEARKSFLRFLNIQNPEMLSFTKPEETVIVRSSYEGKRPHSSYLLVKLEDPTVLQVVNVTKTSLDFTDFTINLKTFPGETNLTMQLWESEGRQTR
LIEEITNIRVSVFRQTEDSLFQEPIHVNSSIFLLVLLMILLNKCAFGCKIELQVLQTVWKRPLPILLGAVTQFFLMPFCGFLLSQILGLSKAQAFGFVMTCTCPGGGGGY
LFALLLEGDVTLAILMACTSTSLALVMMPVNSYLYSCLLGLAGVFHVPVLKIVSTLLFILTPVSIGVVIKHRMPKKAVCLERVVRPLSLTLMLVGVYLAFRMGLVFLRMA
NLEVFLLGLLVPVLGFSFGYSFAKVYLLPLPVCKTVAIESGMLNSFLALAIIQLSFPQSKAYEASVAPFTVAMCSSCEMLLLLLVYKAKKRPLLSTENEKAPLV*
2 >lcl|NP_001037746.1|Plus1complement(1760719..1761636) NW_047566 hypothetical protein LOC682010 MGC93861 __SEG__ Chr1 {Rattus norvegicus} MLWAQRKKRKATTETTEDKPAESHRPNDSWIKSHFSRLSEEKLPAYRRVSSCGYSPEGKHGEANTTLHVDTVTTKHGEGGVALHRDSFASKQKISGTSVSKEMQRESGKS
PSMENDTWAAVAACTKEIDAKGHHVANSVLQRSPEYHRTGHAESRNISPEDLKALEEVELKLKGNFLTHRETVVAGANQAHTVYNQSHHGNQSHQNHNTYPCHQNNQSRS
VHYQGHHPSHLSHQGYPSYSSHQNHPGHPSQQGHSSHSNQQGHLGLSSQQGHPSQSSHQSHQGQPGHPNHQSHSLVNRRNQIYDS*
3 >lcl|NP_001099606.1|Plus17272110..7272823 NW_047513 ferritin mitochondrial Ftmt __SEG__ Chr18 {Rattus norvegicus} MLSCFWFFSKHIGPALMSLPCVLHRFTAPRCLASRYPLSPLLASPRRLLASVASSQGSTGPARVRQNFHPDSEAAINRQINMELYASYVYLSMAYYFSRDDVALYNFSKY
FLRQSLEEREHAEKLMRLQNQRGGRICLQDIKKPDKDDWECGLRAMECALLLEKSVNQSLLDLHTLASEKGDPHLCDFLETHYLHEQVKSIKELGDHVHNLVTMGAPAAG
LAEYLFDKHTLGSESKH*
4 >lcl|NP_001100424.1|Plus112021314..12021835 NW_048034 hypothetical protein LOC302536 RGD1561661 __SEG__ ChrX {Rattus norvegicus} MSAWSHQNYTTEVEAMIDRLISMHLEASDRYLSLGFVFKDDCSVAGLVHFFRDLSEEKRQAAYLLLMQTRQSDCGHFSNGPTVPSYQCDGSLDAMETTLALEKNLNQVLL
DLHALGSSNADFQLCHFLEKHFLEKEMNLIKKISDYLTNLRQQASEEESLSECLLKRLTLNSD*
5 >lcl|NP_001103837.1|Plus113488647..13489177 NW_048034 hypothetical protein LOC691895 LOC691895 __SEG__ ChrX {Rattus norvegicus} MAEAPSQVRQNYDWHCEDAVNTHIQLRLYASYVYMSMAVYFDRDDVALGNFKRFFLSKSHECQAKAEVFMHLQNTRGGCLSLHDIARPERDSWHGGSQAMECALHMEMMI
NQSLLNMHEVAKEKGDAQLCHFLEQNFLNQQVEVLKEVGGYLTNLRQMGAQEHSLAEYLFDKLSLS*
6 >lcl|NP_037102.1|Plus110808027..10809526 NW_047627 potassium voltage-gated channel, shaker-related subfamily, member 2 Kcna2 __SEG__ Chr2 {Rattus norvegicus} MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFS
EEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTD
PFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGL
LIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPS
SPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV*
7 >lcl|NP_037103.1|Plus134183053..34185017 NW_047657 potassium voltage-gated channel, shaker-related subfamily, member 4 Kcna4 __SEG__ Chr3 {Rattus norvegicus} MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGTGGSGGGPHHHHQTRGAYSSHDPQGSRGSRRRRRQRTEKKKLHHRQSSFPHCSDLMP
SGSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEEDHGDGCSYTDLLPQDDGGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEY
FFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETL
PEFRDDRDLIMALSAGGHSRLLNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAMS
FAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGV
LTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV*
8 >lcl|NP_037104.1|Plus1complement(16000056..16001864) NW_047696 potassium voltage-gated channel, shaker-related subfamily, member 5 Kcna5 __SEG__ Chr4 {Rattus norvegicus} MEISLVPLENGSAMTLRGGGEAGASCVQTPRGECGCPPTSGLNNQSKETLLRGRTTLEDANQGGRPLPPMAQELPQPRRLSAEDEEGEGDPGLGTVEEDQAPQDAGSLHH
QRVLINISGLRFETQLGTLAQFPNTLLGDPAKRLHYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPR
NEFQRQVWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGINGSVSGALSSGPTVAPLLPRTLADPFFIVETTCVIWFTFEL
LVRFFACPSKAEFSRNIMNIIDVVAIFPYFITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSA
VYFAEADNHGSHFSSIPDAFWWAVVTMTTVGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGNQRRESGLDTGGQRKVSCSKA
SFCKTGGSLESSDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRETDL*
9 >lcl|NP_058993.1|Plus1complement(1702091..1703053) NW_047799 potassium inwardly-rectifying channel, subfamily J, member 5 Kcnj5 __SEG__ Chr8 {Rattus norvegicus} MAGDSRNAMNQDMEIGVTSQDHKKIPKQARDYIPIATDRTRLLPEGKKPRQRYMEKTGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWL
IAYVRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFR
VGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLEQEEFEVVVILEGMVEATGKTFCPPQP
10 >lcl|NP_062143.3|Plus110718102..10719679 NW_047627 potassium voltage-gated channel, shaker-related subfamily, member 3 Kcna3 __SEG__ Chr2 {Rattus norvegicus} MTVVPGDHLLEPEAAGGGGGDPPQGGCVSGGGCDRYEPLPPALPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAIL
YYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPS
QDVFEAANNSTSGASSGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRH
SKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV*
11 >lcl|NP_073636.1|Plus138244625..38245356 NW_047762 nuclear casein kinase and cyclin-dependent kinase substrate 1 Nucks1 __SEG__ Chr6 {Rattus norvegicus} MSRPVRNRKVVDYSQFQESDDAEGDYGRDSGPPAKKIRSSPRETKNKRRSGKNSQEDSEDSEEKDVKSKKDDSHSAEDSEDEKDDHKSVRQQRQAASKAASKQREMLLED
VGSEEEPEEDDEASFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKTSKEKTPSPKEEDEEAESPPEKKT
SASPPLEKSGDEGSEDEAASGED*
12 >lcl|NP_076444.1|Plus1complement(16225855..16227447) NW_047696 potassium voltage-gated channel subfamily A member 6 Kcna6 __SEG__ Chr4 {Rattus norvegicus} MRSEKSLTLAAPGEVRGPEGEQQDAGEFQEAEGGGGCCSSERLVINISGLRYETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPV
NVPLDIFMEEIRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRADGRGGSNEGSGTRMSPASR
GSHEEEDEDEDSYAFPGSIPSGGLGTGGTSSFSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKAAFFRNIMNIIDLVAIFPYFITLGTELVQRHEQQPVSGGSG
QNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDVDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVG
SLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV*
13 >lcl|NP_076456.1|Plus12577373..2578806 NW_047778 potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2 Kcns2 __SEG__ Chr7 {Rattus norvegicus} MTRQSLWDLSETDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGI
NEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGN
PGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESSPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVG
LLLLYLSVGISIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVP
SVNLRDYYAHKVKSLMASLTNMSRSSPSELSLDDSLH*
14 >lcl|NP_112302.1|Plus121441098..>21441616 NW_047695 glutamate receptor, metabotropic 7 precursor Grm7 __SEG__ Chr4 {Rattus norvegicus} MVQLGKLLRVLTLMKFPCCVLEVLLCVLAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCS
RDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQ
15 >lcl|NP_112648.2|Plus1complement(5572746..5573918) NW_047558 ATP-sensitive inward rectifier potassium channel 11 Kcnj11 __SEG__ Chr1 {Rattus norvegicus} MLSRKGIIPEEYVLTRLAEDPTEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTNVPC
VTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVV
RKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDY
SKFGNTVKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS*
16 >lcl|NP_113790.1|Plus15658975..5660114 NW_047399 potassium inwardly-rectifying channel, subfamily J, member 10 Kcnj10 __SEG__ Chr13 {Rattus norvegicus} MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVV
QVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQT
HQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLF
DQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV*
17 >lcl|NP_114016.1|Plus1322820..>323197 NW_047444 potassium large conductance calcium-activated channel, subfamily M, alpha member 1 Kcnma1 __SEG__ Chr15 {Rattus norvegicus} MANGGGGGGGGSSGSSGGGGGGGGGSGLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSVHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRT
LKYLWTVCCHCGGKTK
18 >lcl|NP_446167.2|Plus132063334..32065490 NW_047354 solute carrier family 5 (inositol transporters), member 3 Slc5a3 __SEG__ Chr11 {Rattus norvegicus} MRAVLETADIAIVALYFVLVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMP
EYLSKRFGGHRIQVYFAALSLLLYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMVISMMKVGGFEEVKRRYMLA
SPNVASILLTHNLSNTNSCMVHPKADALKMLRDPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFVDDIAC
INPEHCMQVCGSRAGCSNIAYPRLVMELVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLLRNNASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLY
IQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAIRLILAFTYRAPECDQPDNRPSFIKDIHYMYVATALFWITGLITVIVSLLTPPPTKDQIRTTTFWSKK
TVVTKESCSQKDEPYKMQEKSILRCSENSEVVSHTIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASMGHSEAETPVDAYSNGQAALMGERAREKETESRSRYWKFIDW
FCGFKSRSLSKRSLRDSMDEEAVCLQMLEETPRVRVILNIGLFAVCSLGIFMFVYFSL*
19 >lcl|NP_446322.2|Plus1complement(12204917..12206257) NW_047780 inward rectifier potassium channel 4 Kcnj4 __SEG__ Chr7 {Rattus norvegicus} MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEPSPSGPTAGGPGGNGGGAAPTA
AKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVR
AQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSHYK
VDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEETGIIRMLEFGSHLDLERMQAATLPLDNISY
RRESAI*
20 >lcl|NP_446433.2|Plus134037028..34038311 NW_047334 potassium inwardly-rectifying channel, subfamily J, member 12 Kcnj12 __SEG__ Chr10 {Rattus norvegicus} MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHG
DLEPAEGRGRTPCVLQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRK
SHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPV
LFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEVATDRDGRSPQPEHDFDRLQASSGALERPYRRESEI*
21 >lcl|NP_775118.1|Plus1complement(16115774..16117261) NW_047696 potassium voltage-gated channel, shaker-related subfamily, member 1 Kcna1 __SEG__ Chr4 {Rattus norvegicus} MTVMSGENADEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPL
DMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDP
FFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI
FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSSPNLASDSD
LSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTATDQNCVNKSKLLTDV*
22 >lcl|XP_001056161.1|Plus15392794..5393198 NW_047561 ferritin light chain 1-like LOC680217 __SEG__ Chr1 {Rattus norvegicus} MTSQIRQNYSTEVEAAVNRLVNLHLRAYLSLGFFFDRDDVALEGVGHFFCELAKEKNLNQALLNLHALGSARIDPHLCDFLESHFLDKEVKLIKKMGNHLTNLRRVAGPQ
PAQTGVAQASLGEYLSECLTLKHD*
23 >lcl|XP_001064595.1|Plus12706823..2707263 NW_047513 vomeronasal 2 receptor, 67-like LOC685631 __SEG__ Chr18 {Rattus norvegicus} MASLMLHFKWTWIGLAITDDDQGIQFLSDLREEMQRHAICLAFVNMIPENMQLNMARVKIYDQQLMTSIAKVVIIYGEMNSTLEVSFRKWGNLGVQRIWITTSQWDVITN
IEDFSLVFFHGTLTFVHCYREIAEFRKFMQTVNTSK*
24 >lcl|XP_002728087.1|Plus14022088..4022642 NW_047399 ferritin light chain 1-like LOC100362384 __SEG__ Chr13 {Rattus norvegicus} MTSQIRQNYSTEVETAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLKLQNERGGRALFQDVQKPSQDEWGKTLEAMEAALALEKNLNQA
LLDLHALGSARTDPPHLCDFLESHFLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGVAQASLGEYLFERLTLKHD*
25 >lcl|XP_002729272.1|Plus128458438..28458986 NW_047658 ferritin heavy chain-like LOC689130 __SEG__ Chr3 {Rattus norvegicus} MTTASPSQVRQNYHQDSEAAINRQINLELYASYVYLSMSCYFDRDGVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKS
VNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMGAPESGMAEYLFDKHTLGQGDES*
26 >lcl|XP_002729599.1|Plus1139467..140018 NW_047725 ferritin light chain 1-like LOC100360087 __SEG__ Chr5 {Rattus norvegicus} MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLKLQNERGGRALFQDVQKPSQDEWGKTLEAMEAALALEKNLNQA
LLDLHALGSARTDPHLCDFLESHFLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGVAQASLGEYLFERLTLKHD*
27 >lcl|XP_002729671.1|Plus1complement(23094531..23095082) NW_047760 ferritin light chain 2 LOC100359668 __SEG__ Chr6 {Rattus norvegicus} MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLKLQNERGGRALFQDVQKPSQDEWGKTLAAMEAALALEKNLNQA
LLDLHALGSARTDPHLCDFLESHFLDKEVKLIKKMGNHLTNLRRVAGPQPVQTGVAQASLGEYLFERLTLKHD*
28 >lcl|XP_002729804.1|Plus1complement(18174628..18175431) NW_047773 vomeronasal 2 receptor 56-like LOC100359514 __SEG__ Chr7 {Rattus norvegicus} MALVCLALCFSVLTALVLGVFLKHRETPIVKANNRTLSYILLTALIFCFLCSLLFVGNPNTTTCILQQTTFGILFTVSVSTVLAKTLTVVLAFRITLPGRRMRGLMVSRI
PKYIIPICTVVQIILYGIWLWTSPPFVDIDTHSEHGCITITCSKGSVMAFYCVLGYLGSLALVSFTVAFLARNLPDTFNEAKFLTFSMLVFCSVWITFLPVYHSSKGKVM
VAVEVFSILASSMGLLGCIFIPKCYIILLRPDRNSIQKFRDKTQMNQ*
29 >lcl|XP_002729857.1|Plus1complement(5571425..5571691) NW_047779 high mobility group nucleosomal binding domain 2 LOC100363319 __SEG__ Chr7 {Rattus norvegicus} MPKRKAEGEAKGDKAKVRDEPQRRSAKLSDKPAPPKPEPKPRKGPAKKWEKIPKGKKGKVSKDANNPAENGDSKTEQAQKAEGAGDNK*
30 >lcl|XP_002730245.1|Plus1complement(13449684..13450214) NW_048034 ferritin heavy chain-like LOC679157 __SEG__ ChrX {Rattus norvegicus} MAEAPSQVRQNYDWHCEDAVNTHIQLRLYASYVYMSMAVYFDRDDVALGNFKRFFLSKSHECQAKAEVFMHLQNTRGGCLSLHDIARPERDSWHGGSQAMECALHMEMMI
NQSLLNMHEVAKEKGDAQLCHFLEQNFLNQQVEVLKEVGGYLTNLRQMGAQEHSLAEYLFDKLSLS*
31 >lcl|XP_002730249.1|Plus113390702..13391352 NW_048034 mCG1037856-like LOC100360830 __SEG__ ChrX {Rattus norvegicus} MGFVRGPRRHQRQRCPPHFQRYRAANALVFMPPPIFSPPSDVRQNFHTDCEAAINRHVRLQLSTSYVYLSMCFYFDREDVALENFSRYFLNKSHECTRNAEIFLALQNQR
GGRISLRTIYKPDCDNWIGGLPAMERAFQLELHLNQSLVAMYQLAARKRDGHLCSFLQTHFLRKQVAVLKEMSSFLISMRQMGSPEVGMAEYLFGKLSLGDNPKEK*
32 >lcl|XP_227577.2|Plus110896926..10898461 NW_047627 potassium voltage-gated channel, shaker-related subfamily, member 10 Kcna10 __SEG__ Chr2 {Rattus norvegicus} MDVCSWREMEVALVNFDNSDEIHEEPGYATDFDPTSSKGRPGSSPFSNWKVLISDNISHETAFSKIPGEYVDPPGSEPVVLNEGNQRVIINIAGLRFETQLRTLNQFPET
LLGDREKRMQFFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDFHRQFWLLFEYPESSSAARGVAV
VSVLVVVISITIFCLETLPEFREDRELKVVRDPTINTNKTGLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKPDFFKNIMNIIDIISIIPYFATLITELVQETEPS
AQQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTL
CAIAGVLTIALPVPVIVSNFNYFYHRETENEEKPNIPGELDKILNSMGSRTGSTESLNKTNSSRSAEKSRK*
33 >lcl|XP_228502.5|Plus1complement(6605562..6607430) NW_048043 rCG63520-like Zcchc5 __SEG__ ChrX {Rattus norvegicus} MVEDLAASYVALKLENEILQAQVKRLTEENAALQAQIPELQKSGAAKEHEPPRKPSEAQELPESPELLELPAARASQNPWEPPATTEPREPTKIREPREPSAISKLRGPP
EIKEPREPSTIRKPRSPSEIKEPRELSAIRDFMGIPEIQEPQEPQEPQEPQETNESGGPSAITEFRGSPEIKKSHSSPKFKECWGLQEFPKVKESWEPPESLDSTTAWGL
QELSKYKKAHKPPELQDLAAWNPATVKEHQEIQKALESPATQKPQASPRGYDLPAVGEAEPTDNQGTPALKELQNSQLHNPTNDAEPQTVPEHQETSSQPEPLEHPATQE
TLEPQVLQEPLDPSDAKEFLELSVPEESLEGLIVVRTGTEQAHHEIEAPTLPLEYPLAFSEDFQKLSEFLVQLNSYLRTRGYPTEAALVSFVGSFFSGEAGRLFQPLLDS
QTSLLEQFERLLRALQDTFDNPDSLEVANQGLPQLRQGEGLAPRYSTRFHLIAQELNLGESTLCIQFQEELASSIQNELSCISPVTNLSDVTIECVTLEEKASGGADSSS
SSSEEENGSESPPTENQPVQATSNRPHLSEAERARRREGHLCLYCGHPGHFARDCPVKPQRAQQAGNMEARR*
34 >lcl|XP_228749.2|Plus1complement(13647598..13648248) NW_048034 mCG1037856-like RGD1561106 __SEG__ ChrX {Rattus norvegicus} MGFVRGPRRHQRQRCPPHFQRYRAANALVFMPPPIFSPPSDVRQNFHTDCEAAINRHVRLQLSTSYVYLSMCFYFDREDVALENFSRYFLNKSHECTRNAEIFLALKNQR
GGRVSLRTIYKPDCDNWIGGLPAMERAFQLELHLNQSLVAMYQLAARKRDGHLCSFLQTHFLRKQVAVLKEMSSFLISMRQMGSPEVGMAEYLFGKLSLGDNPKEK*
35 >lcl|XP_228941.1|Plus1complement(5239457..5239987) NW_048040 rCG36341-like RGD1560203 __SEG__ ChrX {Rattus norvegicus} MAEASSQVRQNYDRCCEEAVNTHIRLLLQASYSYLSMAFYFDRDDVALENFKRFFLSKSHDCKASVEMFVFMQNKRGGHVFLPSIAKPDRKSWQGGFRAMECAFRMEMTI
NQSLLNLHELAKGKGDAHLCNFLGQHCLDQQVHVLKKIGGYLTNLRQMGAPEQALAEYLFDKLSLS*
36 >lcl|XP_574537.1|Plus1complement(11639392..11639943) NW_047562 ferritin light chain 2 RGD1566189 __SEG__ Chr1 {Rattus norvegicus} MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFLFDRDDVALEGVGHFFCELAEEKREGAERLLKLQNEHGGRALFQDVQKPSQDEWGKTLEAMEAALALEKNLNQA
LLDLHALGSARTDPHLCDFLESHFLDKEVKLIKKMGNHLTNLRRVAGPQPVQTGVAQASLGEYLFERLTLKHD*
37 >lcl|XP_576192.1|Plus113799349..13799900 NW_047773 ferritin light chain 1-like RGD1560687 __SEG__ Chr7 {Rattus norvegicus} MTSQIRQNYSTEVEAAVNRLVNLHPRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAQRLLKLQNELGGRALFQDVQKPSQDEWGKTLEAMEAALALEKNLNQA
LLDLHALGSARTDPHLCDFLERHFLDKEVKLSKKMGNHLTNLRRVAGPQPAQTGVAQASLGEYLFERLILKHD*
38 >lcl|XP_576922.1|Plus1complement(9581852..9582574) NW_048034 mCG6108-like RGD1564613 __SEG__ ChrX {Rattus norvegicus} MRKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWKKELEKHREKVLSGNESSSKKRQKKKKEKKKSGRYSSSSSS
SSDSSSSSSDSEDEDKKQTKRRKKKKSHCHKSRETSASDSDSDSKDGSKKKSRDVTEREKRVSKKRKMYEDKPLLSDSLSESDCAEVQAKKKKSGEERERTTDKAKKRRK
HKKHSKKKKKKAASASSDSP*
39 >lcl|XP_577041.1|Plus1complement(1364455..1365006) NW_048049 ferritin light chain 2 RGD1561055 __SEG__ ChrX {Rattus norvegicus} MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFGELAEEKREGAEHLLKLQNERGGRALFQDVQKPSQDEWGKTLEAMEAALALEKNLNQA
LLDLHALGSAHTDPHLCDFLESHFLDKEVKLIKKMGNHLTNLRRVAGLQPEQTGVAQASLGEYLFEHLTLKHY*