SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro P    

ID / Description / Sequence
1 >lcl|XP_001135586.1|Plus1207807..209366 NW_003458835 putative protein FAM47C-like LOC473867 __SEG__ ChrX {Pan troglodytes} MGDQRPQDRPSSPGMDSTPWYCDKPPSKYFAKRKHRRLRFPPVDTQNWVFVKEGMDDSRYGCPSPEDTLVCRRDEFLLPKISLRGPQADPKSRKKKLLKKAALFSELSPA
QPTRKAFVEEVEAQLMAKHPLAMYPNLGEDMPPDLLLQVLKPLDPERKLEDAGSCEGQEKTTDEPTEPGKYPCGEFSPRPPETRVSCLRPEPPKTPVSSLHPEPPETGVS
HLRPEPPKTQVSSLHVEPPETGVSHLYPEPSGTGVSHLHPELPKPRVSSLHPEPPKTHRVSSLRLEPPKTRRVSSLCPEPTKTGASHLKELFQEGTSSTVECVSDSLQRR
HTSRKLRDFKWAGDLGVDEESISSLFDFTPECRATYQDQKNKKANECSSGLKYSMELDEMDEVKFFSQEKDLDGKIQTAPNSHSAQHVKMGYGAWYLKPKLGKKLRSDEP
LIDPKLVLEKPDEPDILDGLYGPIAFKDFILSKGYEMPGIIQRLFARRGWTYDSVKTPIQRAMQVYKYKEDVTDASEED*
2 >lcl|XP_001136873.1|Plus11791197..1792672 NW_003456688 potassium voltage-gated channel subfamily S member 3 isoform 1 KCNS3 __SEG__ Chr2A {Pan troglodytes} MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINE
LFIDSCCSNRYQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDP
VLEGVEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLF
LSVGISIFSVLIYSVEKDDHTSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDIDVDQCSEDAPEKCHELPYFNI
RDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTAK*
3 >lcl|XP_001139116.1|Plus12106687..2107571 NW_003457061 voltage-dependent anion-selective channel protein 2-like LOC471721 __SEG__ Chr5 {Pan troglodytes} MATHGQTWARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTF
DTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLA
WTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA*
4 >lcl|XP_001140139.1|Plus1complement(90495..91040) NW_003458839 ferritin light chain-like LOC739001 __SEG__ ChrX {Pan troglodytes} MSTQSRQKYTSGMEAAIDRLINMHLQASYTYLSLSFYFEGDEMAFKGMGHFFHKLAEEKCEGAKLLLMQNQRSSCGLFQNEQKLLGDEWSGSLATMEAALALEKNLNQAF
LDLHALGSANTDPNLCDFLEKHFLDREVKLIKKMGNYLTNLCRLASRQAGLVEYLFRRLKDDWELPEPSNL*
5 >lcl|XP_001159166.1|Plus12164982..2166571 NW_003457716 potassium voltage-gated channel subfamily A member 6 KCNA6 __SEG__ Chr12 {Pan troglodytes} MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPV
NVPLDIFLEEIRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRVDGRGGNNGGVSRVSPVSRG
SQEEEEEEDDSYTFHHGITPGEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIIDLVAIFHDFITLGTELVQQHEQQPASGGGGQ
NGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGS
LCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV*
6 >lcl|XP_001162925.1|Plus12293498..2294997 NW_003456626 potassium voltage-gated channel subfamily A member 2 isoform 1 KCNA2 __SEG__ Chr1 {Pan troglodytes} MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFS
EEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTD
PFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGL
LIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPS
SPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV*
7 >lcl|XP_001164716.1|Plus115631633..15632355 NW_003456956 extracellular superoxide dismutase [Cu-Zn] isoform 2 SOD3 __SEG__ Chr4 {Pan troglodytes} MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSS
RAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWER
QAREHSERKKRRRESECKAA*
8 >lcl|XP_001168847.1|Plus1complement(32251605..32252924) NW_003457226 sodium/bile acid cotransporter 5 SLC10A5 __SEG__ Chr8 {Pan troglodytes} MIRKLFIVLLLLLVTIEEARMSSLSFLNIEKTEILFFTKTEETILVSSSNENKRPNSSHLFVKIEDPKILQMVNVAKKISSDATNFTINLVTDEEGETNVTIQLWDSEGR
QEGLIEEEIKNVKVKVLKQKDSLLQAPMHIDRNILMLILPLILLNKCAFGCKIELQLFQTVWKRPLPVILGAVTQFFLMPFCGFLLSQIVALPEAQAFGVVMTCTCPGGG
GGYLFALLLDGDFTLAILMTCTSTLLALIMMPVNSYIYSRILGLSGTFHIPVSKIVSTLLFILVPVSIGIVIKHRIPEKASFLERIIRPLSFILMFVGIYLTFTVGLVFL
KTDNLEVILLGLLVPALGLLFGYSFAKVCMLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAPFTVAMCSGCEMLLIILVYKAKKRCIFFLQDKRKRNFLI*
9 >lcl|XP_001170498.2|Plus124389307..24390488 NT_106996 ATP-sensitive inward rectifier potassium channel 15 isoform 2 KCNJ15 __SEG__ Chr21 {Pan troglodytes} MAIMKHLRHFSKCFQSLAMDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVIYYAIAFIH
GDLEPGEPISNHTPCIMKVDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANM
RKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFV
PVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTLLLQQSNV*
10 >lcl|XP_001172529.2|Plus120202564..20204720 NT_106996 sodium/myo-inositol cotransporter-like LOC749966 __SEG__ Chr21 {Pan troglodytes} MRAVLDTADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMP
EYLSKRFGGHRIQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMIISIMEIGGFEEVKRRYMLA
SPDVTSILLTYNLSNTNSCNVSPKKEALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFTDDIAC
INPEHCMLVCGSRAGCSNIAYPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLY
IQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFAYRAPECDQPDNRPGFIKDIHYMYVATGLFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKK
NLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGEKERKKETDDGGRYWKFIDW
FCGFKSKSLSKRSLRDLMEEEAVCLQMLEETRQVKVILNIGLFAVCSLGIFMFVYFSL*
11 >lcl|XP_003311927.1|Plus1<11332976..11334157 NW_003457236 potassium voltage-gated channel subfamily S member 2-like KCNS2 __SEG__ Chr8 {Pan troglodytes} YHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSILSI
LVVMGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLMRIFR
ILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFS
HFYRRQKQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLH*
12 >lcl|XP_003312626.1|Plus1complement(13456245..13456958) NW_003457573 methylosome subunit pICln-like LOC100610636 __SEG__ Chr10 {Pan troglodytes} MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPIT
EFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERSEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEV
DTTPTVAGQFEDADVDH*
13 >lcl|XP_003312985.1|Plus1complement(13050077..13050988) NW_003457668 ATP-sensitive inward rectifier potassium channel 11 KCNJ11 __SEG__ Chr11 {Pan troglodytes} MAWWLIAFAHGDLAPSKGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLC
FMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLAD
EILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS*
14 >lcl|XP_003313022.1|Plus1complement(6028653..6030614) NW_003457669 potassium voltage-gated channel subfamily A member 4 isoform 1 KCNA4 __SEG__ Chr11 {Pan troglodytes} MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGGSHHHHQSRGACTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMP
SGSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYF
FDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLP
EFRDDRDLVMALSAGGHGGLLNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAMSF
AILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVL
TIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV*
15 >lcl|XP_003313460.1|Plus1complement(2069423..2070541) NW_003457709 ATP-sensitive inward rectifier potassium channel 1 KCNJ1 __SEG__ Chr11 {Pan troglodytes} MFKHLRKWVVTRFFGHSRQKPRLVSKDGRCNIEFGNVEAQSRFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTPCVENINGLT
SAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLISSHIYGKLLKTTVTPEG
ETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVE
VETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM*
16 >lcl|XP_003313484.1|Plus12271147..2272634 NW_003457716 potassium voltage-gated channel subfamily A member 1 KCNA1 __SEG__ Chr12 {Pan troglodytes} MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPL
DMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDP
FFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI
FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSSPNLASDSD
LSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTGNCTTANQNCVNKSKLLTDV*
17 >lcl|XP_003316507.1|Plus1complement(2919102..2920316) NW_003458514 dapper homolog 3 isoform 2 DACT3 __SEG__ Chr19 {Pan troglodytes} MRSPRPCGRPPTDSPDVGGAGRPLDGYISALLRRRRRRGAGQPRTSPGGADGGPRRQNSVRQRPPDASPSPGSARPAREPSLERDSGHPTSPAALSRAPSSSWESEAAPE
PAFPPAAPSPPDSPAEGRLVKAQYIPGAQAATRGLPGRAARRKPPPLTRGRSVEQSPPRERPRAAGRRGRMAEASGRRGSPRARKASRSQSETSLLGRASAVPSGPPKYP
TAEREEPRPPRPRRGPAPTLAAQAAGSCRRWRSTAEIDAADGRRVRPRAPAARVPGPGPSPSAPQRRLLYGCAGSDSECSAGRLGPLGRRGPAGGVGGGYGESESSASEG
ESPAFSSASSDSDGSGGLVWPQQLVAATAASGGGAGAGAPAGPAKVFVKIKASHALKKKILRFRSGSLKVMTTV*
18 >lcl|XP_003316833.1|Plus13821200..3821727 NW_003458540 ferritin light chain-like LOC458071 __SEG__ Chr20 {Pan troglodytes} MSSQIHQNYSTDVEAAVNSLVNLYLQASYTYLFLGFYFDRDDAALEGVSHFFRELTEEKREGYERLLKMQNQRGSRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQA
LLDLHALDSACMDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD*
19 >lcl|XP_003317868.1|Plus1<9..>1664 NW_003460518 filaggrin-like LOC100608462 __SEG__ Chr1 {Pan troglodytes} RNQGSSVSQDSDSQGHSEDSERWSGSASRNHHGSAWEQSRDGSRHPGSHQEDRAGHGHSADSSRQSGTHHTESSSRGQAASSHEHARSSAGERHGSHHQQSADSSRHSGI
RRRQASSAVRDSGHRGSSGSQASDSEGHSEESDTQSVSGHGQDGPHQQSHQESARDWSGGRSGRSGSFLYQVSTHEQSESAHGRTTTSTGRRQGSHHEQARDSSRHSASQ
EGQDTIRGHPGSSRGGRQGSHHEQSVDRSGHSVSHHSHTTSQGRSDASRGQSGSRSASRQTRNNEQSGDGSRHSGSRHHEAASRADSSRHSQVGQEQSSGSRTSRHQGSS
VSQDSDSEGHSEDSERWSGSASRNHHGSAREQSRDGSRHPRSHHEDRAGHGHSADSSRQSGTRHTESSSRGQAVSSHEQARSSPGERHGSRHQQSADSSRHSGIGHGQAS
SAVRDSGHRGSSGSQAIDSEGHSEDSDTQSVSSHGQAGPHQQSHKESARGQSGESSGRSGSFLYQVSSHEQSESTYGQTAPSTGGRQDPAMSRHEHSRHPHPKTSDPFRE
PG
20 >lcl|XP_003318153.1|Plus112990..13748 NW_003475484 ATP-sensitive inward rectifier potassium channel 12-like LOC749800 __SEG__ Chr17 {Pan troglodytes} MAKMARPKKRTQMLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVGAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDHSFLVSPITILHEIDEASPLFGISRQDLQM
DDSEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEKNQYKIDYLHFHKTYEVPSTPRCSAKDLVENKFLLPRANSFCYKNELAFLSSDQEDEADRDQDGQSR
DGLSPQARHDFDRLQAGGGVLEQRPYRRESEI*
21 >lcl|XP_003319114.1|Plus124389361..24390488 NT_106996 ATP-sensitive inward rectifier potassium channel 15 KCNJ15 __SEG__ Chr21 {Pan troglodytes} MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMK
VDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTH
VTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQF
EQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTLLLQQSNV*
22 >lcl|XP_516456.2|Plus1complement(406864..408240) NW_003456878 coiled-coil domain-containing protein 71 CCDC71 __SEG__ Chr3 {Pan troglodytes} MSVVVQHVEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTANPPSQTKLQARAPNPTATSPPASAPRTAMRLP
AGRATLLPMPLSGRLAKASTPALAKHATTNLLLSSLKQSSASHARGAAVGFPTHLYPGVYPAMRLSVVLEALVPLKTPMPCLGAKHKAQSLQLSLADSPLKLRKSSGKGP
GNPRPKAPRKTTSKGPKCLTRKGPGAGPRRGSGHQSKTNRATGSPSVRQMKGGSALGTKTAQAKVARTLAKAARAQAKVARTQAKAAKARAKAKAAQVKAKAKAKAAQVK
AKAKAKAKAVRAKAKVARTQPRGRGRPKGSAKARTTRKGQKNRPETVGQKRKRAEEAKDLPPKKRTRLGPRSPKAWLGPGTAKLLKFRAIKVDRRSSDDEMRQQAQRILR
VNLSPVIRLQPLLPYSAV*
23 >lcl|XP_521849.2|Plus1complement(13050077..13051249) NW_003457668 ATP-sensitive inward rectifier potassium channel 11 isoform 2 KCNJ11 __SEG__ Chr11 {Pan troglodytes} MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSKGTAEPC
VTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVV
RKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDY
SKFGNTIKVPTPLCTARQLDEDRSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS*
24 >lcl|XP_522330.1|Plus12407427..2409235 NW_003457716 potassium voltage-gated channel subfamily A member 5 KCNA5 __SEG__ Chr12 {Pan troglodytes} MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDADSGVRPLPPLPKELPRPRRPPPEDEEEEGDPGLGTEEDQALGTASLHHQR
VHINISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNE
FQRQVWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGANGSGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLV
RFFACPSKAGFSRNIMNIIDVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSA
VYFAEADNQGTHFSSIPDAFWWAVVTMTTVGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQGTQSQGPGLDRGVQRKVSGSRG
SFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSLYALCLDTSRETDL*
25 >lcl|XP_523700.2|Plus12096290..2097546 NW_003458347 inward rectifier potassium channel 16 KCNJ16 __SEG__ Chr17 {Pan troglodytes} MSYYGSSYHIVNVDAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITP
CVDNVHSFTGAFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQL
LRYTEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKRKYYKVNCLQFEG
SVEVYAPFCSAKQLDWKDQQLHIEKAPPVRESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM*
26 >lcl|XP_523701.2|Plus12139793..2141076 NW_003458347 inward rectifier potassium channel 2 KCNJ2 __SEG__ Chr17 {Pan troglodytes} MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLH
GDLDASKEGKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKS
HLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVL
FEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRPLRRESEI*
27 >lcl|XP_524797.1|Plus12222627..2224354 NW_003456626 potassium voltage-gated channel subfamily A member 3 KCNA3 __SEG__ Chr1 {Pan troglodytes} MDEHLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNPGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINI
SGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQV
WLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGARAGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNL
IDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAVV
TMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTG
NSTATCTTNNNPNSCVNIKKIFTDV*
28 >lcl|XP_524799.2|Plus12375036..2376571 NW_003456626 potassium voltage-gated channel subfamily A member 10 KCNA10 __SEG__ Chr1 {Pan troglodytes} MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNWKILISESTNHETAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPET
LLGDREKRMQFFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARAVAV
VSVLVVVISITIFCLETLPEFREDRELKVVRDPNLNMSKTVLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFFRNIMNIIDIISIIPYFATLITELVQETEPS
AQQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTL
CAVAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEIERILNSVGSRMGSTDSLNKTNGGCSTEKSRK*
29 >lcl|XP_525593.2|Plus1complement(1634634..1635971) NW_003458656 inward rectifier potassium channel 4 KCNJ4 __SEG__ Chr22 {Pan troglodytes} MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVA
PKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVR
AQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSHYK
VDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYR
RESAI*
30 >lcl|XP_525912.3|Plus1175419..175748 NW_003457455 iron-sulfur cluster assembly 1 homolog, mitochondrial-like LOC470531 __SEG__ Chr9 {Pan troglodytes} MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDXXXXL*
31 >lcl|XP_526991.2|Plus18116786..8117514 NW_003457058 ferritin, mitochondrial FTMT __SEG__ Chr5 {Pan troglodytes} MLSCFRLLSRHISPSLASLCPVRRCFALPLRWAPGCPSDPRQIAPRRPLAAAASSRDPTGPAAGPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNN
FSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKKPDQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGA
PDAGLAEYLFDTHTLGNENKQN*
32 >lcl|XP_528923.2|Plus1complement(4006..4557) NW_003458820 ferritin, heavy polypeptide-like 17 FTHL17 __SEG__ ChrX {Pan troglodytes} MATAQPSQVHQKYDTNCDAAINSHIRLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKTEHAQKLMRLQNLRGGRLCLQDIREPECQGWESGLVAMESAFHLEKN
VNQSLLDLYQLAVEKGDPQLCHFLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET*