SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus P    

ID / Description / Sequence
1 >lcl|NP_001010834.1|Plus1complement(7334294..7335598) NT_078380 sodium/bile acid cotransporter 5 precursor Slc10a5 __SEG__ Chr3 {Mus musculus} MSGNFFIFLLLLVTPGEAKKSFLSFLNIQNTEMLSFTRTEENIVVRSSYKDKQPHSSYLLVKLEDPKVLQVVNVTKTSLAVTDFTVNLKTFPGETNVTLQLWESEGRQTT
LIDELKNVRVRVFRQTDDSLLQAPIHVDSSIFLLVLSMILLNKCAFGCKIEFQVLQTVWKRPLPILLGVVIQFFLMPFCGFLLSQILGLPKAQAFGFVMTCTCPGGGGGY
LFALLLEGDVTLAILMTCTSTSLALIMMPVNSYFYSRLLGLAGAFHVPVLKIVSTLLFILMPMSTGVIIKHKMPAKAICLERVVRPLSLTLMFVGIYLAFRMGLVFLRMA
NLEVFLLGLLVPALGLLFGYSLAKVYLLPLPVCKTVALETGMLNSFLALAIIQLSFSQPKAHEASVAPFTVAMCSSCEMLLLLLVYKAKRRPSLSTEYEKTPLV*
2 >lcl|NP_001033786.1|Plus12231199..2231729 NT_039700 ferritin, heavy polypeptide-like Gm5635 __SEG__ ChrX {Mus musculus} MAEAPSRVRQNYDWQCEDAVNTHIQLYLQSSYEYMSMAFYFDRDDVAQENFKRFFLTKSHNCQTSAEMFMHLQNKRGGCISLQDIARPERNNWHGGFQAMECAFHMEMLI
NQSLLNMHEVAKEKGDPHLCHFLEQNCLDQQVDILKEMSGYLTNLRQMGAVEHNLAEYLFDKLSLS*
3 >lcl|NP_001034145.1|Plus130222286..30223413 NT_039625 ATP-sensitive inward rectifier potassium channel 15 isoform b Kcnj15 __SEG__ Chr16 {Mus musculus} MDAIHLGMSSAPLVKHTNGVGLKAHRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVVYYAIAFIHGDLQLGESNSNHTPCIMK
VDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVISKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTH
VTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQF
EQIRKSPDCTFYCADSEKQKLEEQYRQEDQRERELRSLLLQQSNV*
4 >lcl|NP_001034573.1|Plus116200179..16201318 NT_039185 ATP-sensitive inward rectifier potassium channel 10 Kcnj10 __SEG__ Chr1 {Mus musculus} MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVV
QVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQT
HQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLF
DQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV*
5 >lcl|NP_001074609.1|Plus156379326..56380861 NT_039240 potassium voltage-gated channel subfamily A member 10 Kcna10 __SEG__ Chr3 {Mus musculus} MDVCSWKEMEVALVNFDNSDEIHEEPGYATDFDPTSSKGRPGSSPFSNWRVLISDNTNHETAFSKIPGEYVDPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLNQFPET
LLGDREKRMQFFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDFHRQFWLLFEYPESSSAARGVAV
VSVLVVVISITIFCLETLPEFREDRELKVVRDPSINTNKTGLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFFKNIMNIIDIISIIPYFATLITELVQETEPS
AQQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTL
CAIAGVLTIALPVPVIVSNFNYFYHRETENEEKPNIPGELDKILNSMGSRMGSTESLNKTNGSCSAEKSRK*
6 >lcl|NP_001078993.1|Plus1complement(2130331..2130861) NT_039700 hypothetical protein LOC434726 Gm5634 __SEG__ ChrX {Mus musculus} MAEAPSRVRQNYDWQCEDAINTHIQLRLYASYVYMSMAVYFDRDDVAQENFKRFFLTKSHNCQTSAEMFMHLQNKRGGCISLQDIARPERDSWHGGFQAMECAFHMEMLI
NQSLLNMHEVAKEKGDPHLCHFLEQNCLDQQVDILKEMSGYLTNLRQMGAIEHNLAEYLFDKLSLS*
7 >lcl|NP_001078994.1|Plus1complement(2143915..2144445) NT_039700 hypothetical protein LOC434727 Gm14511 __SEG__ ChrX {Mus musculus} MAEAPSRVRQNYDWQCEDAINTHIQLRLYASYVYMSMAVYFDRDDVAQENFKRFFLTKSHNCQTSAEMFMHLQNKRGGCISLQDIARPERDSWHGGFQAMECAFHMEMLI
NQSLLNMHEVAKEKGDPHLCHFLEQNCLDQQVDILKEMSGYLTNLRQMGAVEHNLAEYLFDKLSLS*
8 >lcl|NP_001092796.1|Plus1complement(2154097..2154627) NT_039700 hypothetical protein LOC100042782 Gm14458 __SEG__ ChrX {Mus musculus} MAEAPSRMQQNYDWQCEDAINTHIQLCLYASYEYMSMAVYFDRDDVAQENFKRFFLTKSHNCQTSAEMFMHLQNKRGGCSSLQGIARPERDSWHGGFQAMECAFHMEMLI
NQSLLNMHEVAKEKGDPHLCHFLEQNCLDQQVDILKEMSGYLTNLRQMGAIEHNLAEYLFDKLSLS*
9 >lcl|NP_032075.2|Plus13096627..3097178 NT_109317 ferritin light chain 2 Ftl2 __SEG__ Chr4 {Mus musculus} MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALALEKNLNQA
LLDLHALGSARADPHLCDFLESHFLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFERLTLKHD*
10 >lcl|NP_032443.3|Plus156289376..56290875 NT_039240 potassium voltage-gated channel subfamily A member 2 Kcna2 __SEG__ Chr3 {Mus musculus} MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFS
EEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTD
PFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGL
LIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPS
SPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV*
11 >lcl|NP_032444.2|Plus156221694..56223280 NT_039240 potassium voltage-gated channel subfamily A member 3 Kcna3 __SEG__ Chr3 {Mus musculus} MTVVPGDHLLEPEAAGGGGGDPPQGGCGSGGGGGGCDRYEPLPPALPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFD
AILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPA
SPSQDVFEAANNSTSGAPSGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKL
SRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY
HRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV*
12 >lcl|NP_032451.1|Plus122474173..22475459 NT_165773 inward rectifier potassium channel 2 Kcnj2 __SEG__ Chr11 {Mus musculus} MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLH
GDLDTSKVSKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKS
HLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVL
FEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPRPLRRESEI*
13 >lcl|NP_032453.3|Plus1complement(40600874..40602211) NT_039621 inward rectifier potassium channel 4 Kcnj4 __SEG__ Chr15 {Mus musculus} MHGHNRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPSVPAAGGPGGNGGASPNAP
KPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRA
QLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSHYKV
DYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQAATLPLDNISYR
RESAI*
14 >lcl|NP_034725.3|Plus1complement(78904848..78906335) NT_039353 potassium voltage-gated channel subfamily A member 1 Kcna1 __SEG__ Chr6 {Mus musculus} MTVMSGENADEASTAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPL
DMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDP
FFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI
FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSSPNLASDSD
LSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV*
15 >lcl|NP_034732.1|Plus1complement(6997901..6999073) NT_039424 ATP-sensitive inward rectifier potassium channel 11 Kcnj11 __SEG__ Chr7 {Mus musculus} MLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTNVPC
VTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVV
RKTTSPEGEVVPLHQVDIPMENGVGGNGIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDY
SKFGNTIKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS*
16 >lcl|NP_034733.3|Plus126387564..26388847 NT_096135 ATP-sensitive inward rectifier potassium channel 12 Kcnj12 __SEG__ Chr11 {Mus musculus} MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHG
DLEPAEGRGRTPCVLQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRK
SHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPV
LFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEVATDRDGRSPQPEHDFDRLQASSAALERPYRRESEI*
17 >lcl|NP_034734.3|Plus122426903..22428162 NT_165773 inward rectifier potassium channel 16 Kcnj16 __SEG__ Chr11 {Mus musculus} MSYYGSSYRIVNVDSKYPGYPPEHAIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYMVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLSDPDITP
CVDNVHSFTAAFLFSLETQTTIGYGYRCVTEECSVAVLTVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQL
LRYSEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYIPREILWGHRFHDVLEVKRKYYKVNCLQFEG
SVEVYAPFCSAKQLDWKDQQLNNLEKTSPARGSCNSDTNTRRRSFSAVAVVSSCENPEETVLSPQDECKEMPYQKALLTLNRISMESQM*
18 >lcl|NP_035235.2|Plus1complement(46931787..46938167) NT_039621 polycystic kidney disease and receptor for egg jelly-related protein precursor Pkdrej __SEG__ Chr15 {Mus musculus} MWPGPALLLLGLGLGLGSQPPPTGPRGLPGVLRGAPGLGQGAESSVRGGDTGGLSPRAAPRHASPTPPRRCPSGAAARVLLKVNSSDPAAAKANVSCQTAPCIMQPVKIN
RKDQNAPLILSRDEEATLNITVRWYCPDALVIRKSWVYFSVASVNDTPDWNRPVLLPQVAVSKGFSLHIPKYALPYGVYVFNFTLSIFRWDLAWPTVTGSDIIYIWVRKR
PLKAVLLGAPRVTVKFSDELILNGSMSYDPEADIPTWGLQFFWYCTTNPRYYSGNYVLVINQAVCHPEQDSLNWPWAVGSVLTIPPKTLRGNGVYYFRMVVQKQNRTAFS
DKTVHVLQGLQPKAHISCIENCGPTLGVSDRFSLFLNCPSCGRQDLYSWSILSLTGHEVMFDWAGQAITRRNGPYLSIKAFAFRNFLENRVWVSLILKSWSGMTTTLRHP
VVINHGPRVGKCKINPASGISMVTKFAVECSDFKDENLPLKYKIIVSELDSIGAISSVEENTLGSVVYSGAEPITPAFFLPVGTVTDEYNVRLYVQVYDSLGTFSQVTLQ
ATVTAPTVRDSSKDVLQQLLNVTMKPTSLLSTLLQKQDWLQAGYLTYVVISVLNNIKGEQELQDDRARLLEHLVKQSLTFAMNTADEIGQSVMVITKLTQKASDLSQADL
EATSFRLRQASQDLQEYQHRHKHLQQVEVVGTGILTSLSNLLKLINPYYTLQDPLFVVESLSDTILANKVPGSKTTALRTSNFNMYVEKVENWNVFKAFRNDSLCPNCLR
ATLNASTVPRLPAKAPISMMFCEFADDPFPWLTYPENISVDVVGFRMTGVADNNKVIEITPDIAEVYLVRKDLTPSSFNLTVGPGIKSDGFSKVTTGGISFEVDSRWTGE
LLIHIVTNVTVLFEALVYEGCQLTPTNLMATFLVPNDIPPIVKWSGLFDPTCSVKEARVVCLSSSLLRSIAQRRFSFKYNISMVLQASRFVLKPTNKLVRIALFMVHCLD
MYGIQSDWQQSTCVLGEKTTWKTVHCVCRNGRRSRRQLTSVKLTYHHLHTHFVTAKVIVVPNPVDLRLAIISNLTQNPATFLAVLFIMILYAILAFWALHRDVIDLYFRD
NVVILTDNDPFDTLCYLVTIFTGSRWGSGTRANVFIQLMGTEGTSDVHCLSHPYFKTLYRGSINTFLLTTKNDLGDIHSIRVWHDNSGEAPSWYLSRIKVENLFNKRIWL
FVCRRWLSVDTTLDATFSVTNPDEPLKRTDFFMIDVRDKLRKNHMWISIFTEIVPKPFNRLQRLSCCLAMLLSSLVCNIMFFNLNQKEKIESRHMHIIRSMLIGIESVVI
TIPVQLLITFFFTYSQKNLKMNLDKVAPQKHPLMSEEGLSWKERLHKWHEYEMKALPRRAAVSTSAPEEKEAFETSQKHEKADTQMSNKNSSNNNQEASEGVPPKAFSSQ
PHTTESVQKKTQIILPRWCVYIAWFLVFATSGISSFFIVFYGVTYGYAKSIEWLFASFCSFCQSVFLVQPCNILLRSGTRSYKPKYCKNLSWSSKYHYSEIRLQGLTMTQ
EEMEQLHEDIAYVRSLSMYQPITEDKIQILRRENRIRRRSFLFLSYLVTHFIFLTLLLLLIFSLRHNDSFYYNQFIRHRFSVDLATVMKLGDIYTWLHGVFLPLLHNDPN
PTFLPDSSSKILGLPLVRQVRARPSNKTCLLAKKFVQSSVAGEIHCHPQYGIDPEDTQHYSSVWSKAGKQSTDKASHGFTYKPPGKRWVYHSYGVLNTYGSGGYVFYFFP
GQQMFNSTVRLKELEGKNWLDELTWAVIVELTTLNPDTSLMCSISVVFEVSPLGVVNSSLSVYSFSLADFNRKTSSEIYLYAAILIFFCAYVVDEGYIIRQERASYIRSV
YNLLNFSLKCMFALLIVLFFWKYFLATKMVQLYLADPEAFIPFHAVSRVDHFMRIILAFLLFLTILKTLRYSRFFYNVRLAQKAIQAALPGICHTALVVSIYSFMYVAFG
YLVFGQHEWNYSNMIHATQTIFSYCVSAFQNTEFSGNKVLGVLFLSSFMLVMICIFINLFQAVILSAYDEMKQPVYEEPSDEAEAVTYLCNRLKSGFDFLTTRSRDKDQS
NFFVDMLYGQPEKNTRRFLGLKARNINGKKMIYLVV*
19 >lcl|NP_035565.1|Plus115707305..15708060 NT_039305 extracellular superoxide dismutase [Cu-Zn] precursor Sod3 __SEG__ Chr5 {Mus musculus} MLAFLFYGLLLAACGSVTMSNPGESSFDLADRLDPVEKIDRLDLVEKIGDTHAKVLEIWMELGRRREVDAAEMHAICRVQPSATLPPDQPQITGLVLFRQLGPGSRLEAY
FSLEGFPAEQNASNRAIHVHEFGDLSQGCDSTGPHYNPMEVPHPQHPGDFGNFVVRNGQLWRHRVGLTASLAGPHAILGRSVVVHAGEDDLGKGGNQASLQNGNAGRRLA
CCVVGTSSSAAWESQTKERKKRRRESECKTT*
20 >lcl|NP_038596.1|Plus1complement(79001315..79002904) NT_039353 potassium voltage-gated channel subfamily A member 6 Kcna6 __SEG__ Chr6 {Mus musculus} MRSEKSLTLAAPGEVRGPEGEQQDAGEFQEAEGGGGCCSSERLVINISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPV
NVPLDIFMEEIRFYQLGEEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRADGRGGSNEGSGTRLSPASR
SHEEEDEDEDSYAFPGSIPSGGLGTGGTSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKAAFFRNIMNIIDLVAIFPYFITLGTELVQRHEQQSVSGGSGQ
NGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDVDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGS
LCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRPSYLPTPHRAYAEKRMLTEV*
21 >lcl|NP_059087.2|Plus126782379..26784535 NT_039625 sodium/myo-inositol cotransporter Slc5a3 __SEG__ Chr16 {Mus musculus} MRAVLEAADIAVVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMP
EYLSKRFGGHRIQVYFAALSLLLYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMVISMVKIGGFEEVKRRYMLA
SPDVASILLKYNLSNTNACMVHPKANALKMLRDPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRIVFADEIAC
INPEHCMQVCGSRAGCSNIAYPRLVMTLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLY
IQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFTYRAPECDQPDNRPGFIKDIHYMYVATALFWITGLITVIVSLLTPPPTKDQIRTTTFWSKK
TLVTKESCSQKDEPYKMQEKSILQCSENSEVISHTIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASMGHSEAETPVDAYSNGQAALMGEREREKETENRSRYWKFIDW
FCGFKSKSLSKRSLRDLMDEEAVCLQMLEETPQVKVILNIGLFAVCSLGIFMFVYFSL*
22 >lcl|NP_062633.1|Plus118986404..18987522 NT_039472 ATP-sensitive inward rectifier potassium channel 1 isoform 2 Kcnj1 __SEG__ Chr9 {Mus musculus} MFKHLRRWFVTHIFGRSRQRARLVSKDGRCNIEFGNVDAQSRFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTPCVENINGMT
SAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEG
ETIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGTVESTSATCQVRTSYIPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVE
VETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDETDDTQM*
23 >lcl|NP_062638.1|Plus11167022..1168149 NT_039634 ATP-sensitive inward rectifier potassium channel 15 isoform b Kcnj15 __SEG__ Chr16 {Mus musculus} MDAIHLGMSSAPLVKHTNGVGLKAHRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVVYYAIAFIHGDLQLGESNSNHTPCIMK
VDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVISKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTH
VTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQF
EQIRKSPDCTFYCADSEKQKLEEQYRQEDQRERELRSLLLQQSNV*
24 >lcl|NP_067250.2|Plus148176382..48178346 NT_039207 potassium voltage-gated channel subfamily A member 4 Kcna4 __SEG__ Chr2 {Mus musculus} MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGTGGSGGGPHHHHQTRGAYSSHDPQGSRGSRRRRRQRTEKKKLHHRQSSFPHCSDLMP
SGSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEEDHGDGCSYTDLLPQDDGGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEY
FFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETL
PEFRDDRDLIMALSAGGHSRLLNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAMS
FAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGV
LTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDESETDKNNCSNAKAVETDV*
25 >lcl|NP_080028.1|Plus135238817..35239731 NT_039687 hypothetical protein LOC66765 4933411K16Rik __SEG__ Chr19 {Mus musculus} MLWAHRKKRKAATETTEDKPLESHRANDSWIKSHFSRLSEERLPTYRYVSNNGHSPESRHGEVNTTLHVDTLTTKHGERGAALHRDSFASKQKISGSSMTKEMQRESGKS
PSMEDDTWAAVAACTKEIDAKGHRVANSMLQRSTTHRRKGHAESRNISPEELKALEEVEIKLKGNFLTHHETGVAGANQSHTVYSQSRHSNQSHHSYPSHQSNQSHPVYS
SYQGHHPSHLSPQSYPSYSSHQSHPGHSNHQGHSGLSSHQTHLGHSNHQGHPGHSSHQSHQGQPGHPSHQSHNLPNRRNPIYGS*
26 >lcl|NP_080562.2|Plus149491268..49491981 NT_039674 ferritin, mitochondrial precursor Ftmt __SEG__ Chr18 {Mus musculus} MLSCFWFFSKHISSALMSLPRVLHRFTAPQCLASRYPLGPLLASPRRLLASVASSQDSTRPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALYNFSKY
FLRQSLEEREHAEKLMKLQNQRGGRICLQDIKKPDKDDWECGLRAMECALLLEKNVNQSLLDLHTLASEKGDPHLCDFLETHYLHEQVKSIKELGDHVHNLVTMGAPAAG
LAEYLFDKHTLGSESKH*
27 >lcl|NP_082322.1|Plus130099059..30099607 NT_039706 hypothetical protein LOC71996 1600014K23Rik __SEG__ ChrX {Mus musculus} MAASVPQLEQTYLSESNAALNSQIQLQLYGSYIYLSMASFCNKEEVALGSFALFFLRQSQKWMERTEMLFSLLTERQGSLTLGRIANQDRQDWLDGLMAMECAFHLEKTL
NQSLLQLYGLANSKGDLYLCNFLKCHFLPQQVEILKEMGGYMTNLRRLGAPENQDAEKLFDQLTMADSIKKN*
28 >lcl|NP_112551.2|Plus12201670..2202200 NT_039700 ferritin heavy polypeptide-like 17 Fthl17 __SEG__ ChrX {Mus musculus} MAEAPSRMQQNYDWQCEDAINTHIQLCLYASYEYMSMAVYFDRDDVAQENFKRFFLTKSHNCQTSAEMFMHLQNKRGGCSSLQGIARPERDSWHGGFQAMECAFHMEMLI
NQSLLNMHEVAKEKGDPHLCHFLEQNCLDQQVDILKEMSGYLTNLRQMGAVEHNLAEYLFDKLSLS*
29 >lcl|NP_598505.1|Plus17371044..7372345 NT_039477 coiled-coil domain-containing protein 71 Ccdc71 __SEG__ Chr9 {Mus musculus} MSMVVQPVEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKLQARTINPPATSLPKTAVSVPAGRT
TLLPVPLSGRLAKGSTAALAKHATTNLLLSSLKQSSASNSSGTTVGFPAHLYPGVYPAMRLSVVLEALVPLKTPCLDVKHGAQSLQLSLAKSPLKVRKASGNPKSKAPRK
ITSKGLKHLTSKGPGAGLRRGAGTQSNGAQRKGCSALGPKTVQAQASQTLIKAARAHASVAQTQTKTVRVRAKAKQAKPKAARAKAKAAVVRDKAKDKVIQAKAKAAQTK
HKGKPKGSVQTRTGRANRKNSSETVGRKRKKAEETKGLPPKKRARCVPRPPKVWLGPGTAKPRKSQTIKVDRKCSDDEVRQCAQQILRVNLSPVVWLQPLLPF*
30 >lcl|NP_663381.1|Plus1complement(19198897..19200318) NT_039706 P3 protein Slc10a3 __SEG__ ChrX {Mus musculus} MVVKKSRGSSQQLPGLGGQGGCTGFVGMLGTALLFISLPWGAQVMASANISTALGHTSGHYLSIGDGSVTEFDFPEKSEGIIVISSQYTGQTNGTGPSPILKVISLDTEV
LTIKNVSAITWSSGGGFVVGIHSGLAGLAPLHLQLMDFYEAPPLLIEERRDFCIRVSPAEDLPSALNTNLGHFSENPILYLLLPLIFVNKCSFGCKVELEVLKELLQSPQ
PMLLGLLGQFLVMPFYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFISTVAATGFLPLSSAIYSYLLSIHETLHVPISKILGTLLFIAIPI
AAGVVIKSKLPKFSELLLQVIKPFSFILLLGGLFLAYHMGVFILVGVRLPIVLVGFTVPLVGLLVGYSLAICLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADY
ASQAPFIVALSGTSEMLALVIGQFIYSILFPVP*
31 >lcl|NP_663543.1|Plus123546942..23547712 NT_039353 lysine-rich coiled-coil protein 1 Krcc1 __SEG__ Chr6 {Mus musculus} MKHSNKPYDSFQDELEDYIKVQKARGLEPKTCFRRMRGEYLESCGYREEFDSRPRYRMFDQRLPSGTNHSYPRSCSSSQTEDRVPQWLPAHDKIRLNSLSYCQFTRDGFS
EKPVPLNLSQQEYNCGSYSVESVVHKRLCSEHSTIDPQVSHRQMHQKRKKHVEEGREKQEERPKHERKRSSEEMDLNKHRSIQRKKTKAETETVQDGTEKLKNRKEKKTR
DVSSKKEDRKRRKEKKEQGEERTEEEMLWDQSILGF*
32 >lcl|NP_666095.1|Plus1complement(78796335..78798143) NT_039353 potassium voltage-gated channel subfamily A member 5 Kcna5 __SEG__ Chr6 {Mus musculus} MEISLVPMENGSAMTLRGGGEAGASCVQSPRGECGCPPTAGLNNQSKETSPRRRATHEDAGQGGRPLPPMPQELPQPRRPSAEDEEGEGDPGLGTVEEDQAPQDSGSLHH
QRVLINISGLRFETQLGTLAQFPNTLLGDPVKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPR
NEFQRQVWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGANGSGSGVLSSGPTVAPLLPRTLADPFFIVETTCVIWFTFEL
LVRFFACPSKAEFSRNIMNIIDIVAIFPYFITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSA
VYFAEADNQGSHFSSIPDAFWWAVVTMTTVGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGIQRRESGLDTGGQRKVSCSKA
SFCKTGGPLESTDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRETDL*
33 >lcl|NP_775593.1|Plus1complement(8098027..8099502) NT_039548 potassium voltage-gated channel subfamily S member 3 isoform 1 Kcns3 __SEG__ Chr12 {Mus musculus} MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFDRNPFLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINE
LFIDSCCSSRYQERKEESHDKDWDQKSNDVSTDSSFEESSLFEKELEKFDELRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDP
VLEGVEIACIAWFTGELAIRLVAAPSQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLF
LSVGISIFSVLIYSVEKDEHKSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKIIASTCIICGILVVALPITIIFNKFSKYYQKQKDMEVDQCSEDPPEKCHELPYFNI
RDVYAQQVHAFITSLSSIGIVVSDPDSTDASSVEDNEDAYNTASLENCTGK*
34 >lcl|NP_851834.1|Plus125783720..25785153 NT_039618 potassium voltage-gated channel subfamily S member 2 Kcns2 __SEG__ Chr15 {Mus musculus} MTRQSLWDVSDTDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGI
NEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGN
PGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESSPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVG
LLLLYLSVGISIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVP
SVNLRDYYAHKVKSLMASLTNMSRSSPSELSLDDSLH*
35 >lcl|NP_963289.2|Plus1complement(14181507..14183024) NT_039548 potassium voltage-gated channel subfamily F member 1 Kcnf1 __SEG__ Chr12 {Mus musculus} MEPGLASEPAGSMDASAEQSLPEPGSQDSVAGEDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEV
HMKKGICPICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQ
VVDSEGNRVEHPTLENVETACIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALK
RSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLETAAKHELE
LMELNSSSAEGKPGGSRSDLDTLPPEPAAREGPSWGSRLKLSHSDTFIPLLTEEKHHRTRLQSCK*
36 >lcl|XP_484225.3|Plus110413834..10414223 NT_039578 iron-sulfur cluster assembly 1 homolog, mitochondrial AK157302 __SEG__ Chr13 {Mus musculus} MSASLVRATVWAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEF
VFNNPNIKGTCGCGESFHV*
37 >lcl|XP_486618.1|Plus12211759..2212277 NT_039700 ferritin heavy polypeptide-like 17-like Gm14499 __SEG__ ChrX {Mus musculus} MAEAPSRVRQNYDWQCEDAINTHIQLRLYASYVYMSMAVYFDRDDVAQENFKRFFLTKSHNCQTSAEMFMHLQNKRGGCISLQDIARPERDSWHGGFQAMECAFHMEMLI
NQSLLNMHEVAKEKGDPHLCHFLEQNCLDILKEMSGYLTNLRQMGAVEHNLAEYLFDKLSLS*