SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul P    

ID / Description / Sequence
1 >lcl|NP_001028031.1|Plus11441620..1442903 NW_001102979 inward rectifier potassium channel 2 KCNJ2 __SEG__ Chr16 {Macaca mulatta} MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLH
GDLDASKEGKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKS
HLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVL
FEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRPLRRESEI*
2 >lcl|XP_001083604.1|Plus11400550..1401806 NW_001102979 inward rectifier potassium channel 16 isoform 1 KCNJ16 __SEG__ Chr16 {Macaca mulatta} MSYYGSSYHIVNVDAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIALHHGDLLNDPDITP
CVDNVHSFTGAFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQL
LRYTEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKRKYYKVNCLQFEG
SVEVYAPFCSAKQLDWKDQQLHIEKAPPVRGSCTSDTKARRRSFSAVAIVSSCENPEETTTSAAHEYRETPYQKALLTLNRISVESQM*
3 >lcl|XP_001085668.2|Plus161131..61802 NW_001218108 ferritin heavy chain-like LOC697062 __SEG__ ChrX {Macaca mulatta} MVVLRGLRRGRHSRCRCRCPLRDPRDHTALPRLLPAPALPALGPLSQVRQNYHPSCEVAVNVNVNLELYASYVYLSMAFYFDRDDVALESFSCYFLRQWHKKREHAQELM
RLQNLRGGRICLSDIRKPERQGWEGGLKAMECAFDLEKKVNKSLLELHQLAKQNGDPQLRDFLENHFLNQQAKTIKELGGYLSNLRKMGAPPAAGLAEYLFDKLTLGRSE
KDT*
4 >lcl|XP_001085869.1|Plus12166274..2167020 NW_001218164 protein FAM133A-like LOC697760 __SEG__ ChrX {Macaca mulatta} MGKRDNRVAYMNPIAMARWRGPTQSVGPTIQDYLNRPRPTWEEVKKQLENKKTGSKALAEFEEKMNENWKKELEKSREKLLSGNESSSKKREKKRKKKKKSCRSSSSSSS
SDSSSSSSDSEDEEKKQGKRRKKKKNRSYKSSQSSTYESESESKESVKKKKKSKDETEKEKDIRSLSKKRKKSYPGDKPLSSESSSESDYEEDVQAKKKRRCEEREQAKE
KVKKKKKKQHKKRSKXXXXXXXXEKKQE*
5 >lcl|XP_001086699.1|Plus12127920..2128222 NW_001122901 zinc transporter ZIP3-like LOC698174 __SEG__ Chr8 {Macaca mulatta} MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKLNKGLGLDLGFPTGGLVGCHLIIRPDHPPR*
6 >lcl|XP_001087665.1|Plus1390103..391587 NW_001098990 potassium voltage-gated channel subfamily F member 1 KCNF1 __SEG__ Chr13 {Macaca mulatta} MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFK
NEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQVLDAEGNRVEHP
TLENVETACIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMY
LAVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLETAAKHELELMELNSSSGGEG
KTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK*
7 >lcl|XP_001088267.1|Plus13765235..3767193 NW_001100377 potassium voltage-gated channel subfamily A member 4 KCNA4 __SEG__ Chr14 {Macaca mulatta} MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGSHHHHQSRGACTSHDPQSSRGSRRRRRQRLEKKKAHQRQSSFSHCSDLMPS
GSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFF
DRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPE
FRDDRDLVMALSAGGHGGLLNDTSAPHPENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAMSFA
ILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLT
IALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV*
8 >lcl|XP_001088423.1|Plus1162276..163250 NW_001218113 zinc transporter ZIP1-like LOC701494 __SEG__ ChrX {Macaca mulatta} MGPWGEPELLVWHPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRQPGANHEASAFRQKALSPVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFP
LQEFILAMGFFLVLVMEQITLAYKEQSGLSPLEETRALLGTVNGGPQHWHNGPGVPQASGTPASPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGI
LAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIRLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLADFALLTGLLFIQI*
9 >lcl|XP_001088733.1|Plus15371209..5371940 NW_001120982 ferritin, mitochondrial-like LOC699743 __SEG__ Chr6 {Macaca mulatta} MLSCFRLLSRHISPSLASLRPLRRCFALPLRWAPGRRPSDPRPIAPRRTLTAAASSGDPTCPAAGSSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALN
NFARYFLHQSREETEHAEKLMRLQNQRGGRICLQDIKKPDQDDWKSGLHAMECALLLEKNVNQSLLELHTLASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKLG
APDAGLAEYLFDIHSLGNENKQN*
10 >lcl|XP_001089155.1|Plus1873387..874559 NW_001100380 ATP-sensitive inward rectifier potassium channel 11 KCNJ11 __SEG__ Chr14 {Macaca mulatta} MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPNEGTAEPC
VTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVV
RKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDY
SKFGNTIKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVAMAKAKPKFSISPDSLS*
11 >lcl|XP_001092832.2|Plus1complement(11525653..11526984) NW_001122906 sodium/bile acid cotransporter 5 SLC10A5 __SEG__ Chr8 {Macaca mulatta} MSAFKMIRKLFIVLLLLLVTIEEARMSSLSFLNIEKTEILFFTKTEETIIVSSRYEDKQPNSSHLFVKIEDPKILQMVNVTKKISSDATDFTINLVTDEEGETNVTIQLW
DSEGRQERLIEEIKNVKVKVLKQKDSLLQASMPIDRNILMLILPLILLNKCAFGCKIELQVFQTVWKRPLPVILGAVTQFFLMPFCGFLLSQIVALREAQAFGVVMTCTC
PGGGGGYLFALLLDGDFTLAILMTCTSTFLALIMMPVNSYIYSKILGLSGTFHIPVSKIVSTLLFILVPVSIGIVIKRRIPEKASFLERIIRPLSFILMFVGIYLTFAVG
LMFLKTDNLEVILLGLLVPALGLLFGYSFAKVCMLPLPVCKTVAIESGMLNSFLALAIIQLSFPQSKANLASVAPFTVAMCSGCEMLLIILVYKAKKRCIFFLQDKRKRN
SLI*
12 >lcl|XP_001093116.1|Plus17258437..7259912 NW_001098990 potassium voltage-gated channel subfamily S member 3 isoform 3 KCNS3 __SEG__ Chr13 {Macaca mulatta} MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINE
LFIDSCCSNRYQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTQRFGQLRKKIWIRMENPAHCLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDP
VLEGVEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLF
LSVGISIFSVLIYSVEKDDHTSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDIDVDQCSEDVPEKCHELPYFNI
RDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTAK*
13 >lcl|XP_001094800.1|Plus110487524..10488957 NW_001122911 potassium voltage-gated channel subfamily S member 2 KCNS2 __SEG__ Chr8 {Macaca mulatta} MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGI
NEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSILSILVVMGSIITMCLNSLPDFQIPDSQGN
PGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVG
LLLLYLSVGISIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVP
SVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLH*
14 >lcl|XP_001094935.1|Plus1complement(1019612..1021045) NW_001218202 p3 protein isoform 3 SLC10A3 __SEG__ ChrX {Macaca mulatta} MVLMQGRGSSQQWPGVGGEDGGTGPLGMLRAALLLISLPWGARGTASSSLSTAGGHTVPLTGGRYLSIGDGSVMEFEFPEESEGIIVISSQYPGQANRTVPSPMLRVTSL
DTEVLTIKNVSAITWGGGGGFVVSIHSGLAGLAPLHIQLLDPREAPPTLIEERRDFCIKVSPAEDSPAPLSTDLAHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLM
QSPQPMLLGLLGQFLVMPLYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFISTVAATGFLPLSSAIYSHLLSIHETLHVPISKILGTLLFI
AIPIAVGVLIKSKLPKFSQLLLQVIKPFSFVLLLGGLFLAYRMGVFILAGVRLPIVLVGITVPLVGLLVGYCLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRL
QADYASQAPFIVALSGTSEMLALVIGHCIYSSLFPVS*
15 >lcl|XP_001096278.2|Plus1complement(2026576..2027127) NW_001218104 ferritin heavy polypeptide-like 17-like LOC707851 __SEG__ ChrX {Macaca mulatta} MATAQPSQVRQKYDTNCEAAINSHIRLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMKFQNLRGGRIRLHDIRKPERQGWESGLVAMESAFHLEKN
VNQSLLELYQLAVEKGDPQLCHFLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGSRVKET*
16 >lcl|XP_001101275.1|Plus1complement(1477272..1478807) NW_001108771 potassium voltage-gated channel subfamily A member 10-like LOC702008 __SEG__ Chr1 {Macaca mulatta} MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNWKILISDSTNHETAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPET
LLGDREKRMQFFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARSVAV
VSVLVVVISITIFCLETLPEFREDRELKVVREPNLNMSKTVLSQTMFTDPFFMVESTCIMWFTFELVLRFVVCPSKTDFFRNIMNIIDIISIIPYFATVITELAQETEPS
AQQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTL
CAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPSEIERILNGVGSRMGSTDSLSKTNGGCSTEKSRK*
17 >lcl|XP_001101471.1|Plus1complement(1565966..1567465) NW_001108771 potassium voltage-gated channel subfamily A member 2 isoform 2 KCNA2 __SEG__ Chr1 {Macaca mulatta} MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFS
EEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTD
PFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGL
LIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPS
SPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV*
18 >lcl|XP_001101652.1|Plus1complement(1634350..1636077) NW_001108771 potassium voltage-gated channel subfamily A member 3 KCNA3 __SEG__ Chr1 {Macaca mulatta} MDEHLSLLRSPPPPSARHRAHPAQRPASSGGAHTLVNPGYAEPAAGPELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINI
SGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQV
WLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDSFDAAGNSTSGAAAGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNL
IDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAVV
TMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTG
NSTATCTTNNNPNSCVNIKKIFTDV*
19 >lcl|XP_001101937.1|Plus147594..49186 NW_001096604 potassium voltage-gated channel subfamily A member 6 isoform 2 KCNA6 __SEG__ Chr11 {Macaca mulatta} MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPV
NVPLDIFLEEIRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRVDGRGGSNGGGVSRVSSVSR
GSQEEEEDEDDSYTFHHGITPGEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIIDLVAIFPYFITLGTELVQQQEQQPASGGGS
QNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVG
SLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPAPDLKATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV*
20 >lcl|XP_001102294.1|Plus1281066..282883 NW_001096604 potassium voltage-gated channel subfamily A member 5-like LOC711886 __SEG__ Chr11 {Macaca mulatta} MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDADPGVRPLPPLPKELPQPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQR
VHINISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNE
FQRQVWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGTNGSGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLV
RFFACPSKAGFSRNIMNIIDVVAIFPYFITLGTELAEQQPGGGGGSQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSA
VYFAEADNQGTHFSSIPDAFWWAVVTMTTVGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQGPQSQGPGLDRGVQRKVQESSG
SRGSFCKAGGTLENADSARRSSCPLEKCNVKAKSNVDLRRSLYALCLDTSRETDL*
21 >lcl|XP_001104273.1|Plus11856355..1857656 NW_001102951 ATP-sensitive inward rectifier potassium channel 12-like isoform 1 KCNJ12 __SEG__ Chr16 {Macaca mulatta} MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVVHG
DLEPAEGRGRTPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRK
SHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPV
LFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGSGALEQRPYRRESEI*
22 >lcl|XP_001104405.1|Plus14929702..4930253 NW_001122888 ferritin heavy chain isoform 1 FTH1 __SEG__ Chr8 {Macaca mulatta} MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDYDDWESGLNAMECALHLEKN
VNQALLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES*
23 >lcl|XP_001106198.1|Plus116292736..16293458 NW_001118139 extracellular superoxide dismutase [Cu-Zn]-like isoform 2 LOC715931 __SEG__ Chr5 {Macaca mulatta} MLALLCSCLLLAAGASDAWTGKDSAEPNSDLAESIRDMHAKITEIWQELTQRRDGDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLEAFFALEGFPTQPNNSS
RAIHVHQFGDLSQGCESTGPHYNPLAVPHPRHPGDFGNFAVRDGSLWKYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWER
QAREHSERKKRRRESECKAV*
24 >lcl|XP_001109704.1|Plus15825737..5827161 NW_001112550 coiled-coil domain-containing protein 71-like LOC707774 __SEG__ Chr2 {Macaca mulatta} MSVVVQHVEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTANPPSQTKLQARAPNPTATSPPASAPRTAMRLP
AGRATLLPMPLSGRLAKASTPALAKHATTNLLLSSLKQSSASHARGAAVGFPTHLYPGVYPAMRLSVVLEALVPLKTTMPCLGAKHKAQSLHLSLADSPLKLRKSSGKGP
GNPRPKAPRKTTSKGSKCLTRKGPGAGPRRGSGHQSKTNRATGSPSVRRMKGGSALGTKAAQAKVARTLAKAARSQARVARTQAKAAKARAKAKAARAKAKAARVKAKAK
AKAARVKAKAKVMAARAKAKTKAKAVRAKAKVARTQPRGRGRPKGSAKTRTTRKGQKYRPETVGQKRKRAEEAKDLPPKKRTRLGPRSPKAWLGPGTAKLLKFRAIKVDR
RSSDDEVRQRAQRILRVNLSPEIRLQPLLPHSAV*
25 >lcl|XP_001110678.1|Plus1complement(259278..266033) NW_001095189 polycystic kidney disease and receptor for egg jelly-related protein PKDREJ __SEG__ Chr10 {Macaca mulatta} MRPGPALLLLGLGLGLSLGRLPLPPAPREAQAAVSGAPGGLLRGAQGLGVRGGRALLSLRPSAVRAGGVVLSGRGSLCFPRGGARWRWYCLVLRVLLSAQRLPRPAAPTL
VDLQLTARGGRLSLTWSAPLPRWPRRLAWAFRLRLLGPGAARPGSPAIRVFPRSAAPGPRPQPGFVARTECPTDGPARLMLQAVNSSRHRAVESSVSCQINTCVIQRVRI
NTDQRGAPVRLSMKAEATLNASVQLDCPAALAISQYWQVFSVPAVGDAPDWTQPLDVPQLEIRKSPMFIHIPSNSLQWGVYVFNFTVSITTRNPKMPEVKDSDAVYVWIV
RSSLQAVMLGDVNITANFTEQLILDGSTSSDPDADSPLQGLQFFWYCTTDPRNYRGDGIILGSKEVCHPEQATLKWPWATGPVLTLLPETLKGDHVYFFRMVIQKDSRTA
FSDKRVHVLQGPKAIAHITCIENCERTFIVSDRFSLFLNCTNCASRDFYTWSILSSSGGEMLFDWMGETVTGRNSAYLSIKAFAFQHFLEAEFSISLHLASWSGVTSVFR
HYFIINHGPQIGECKINPSKGIALITKFVVQCSNFRDKHVPLTYKIIVSDLHSVGEISSVKENTLGTILYLGPQSTSPPSFLPVGMVANQYALKIYVQVYDSLGAFSQVT
LHATAQAPTDKNSSKTVLNQLLSFTMGPSSLLSTLIQKQDFLPAGYLLYIVASILNNMRTELPLQNDRVNLRKHLINQSFLLPVSTVVEIGQVVMTITKLTQKPSEFTWD
AQKRATMRIWQANQALQEYQQKDKRFRSEQIEIVSTGILMSLSNILKMTSPHQVVKDPFYVIESLSDTILANKVPGNKTTSMRTPNFNMYVKKVEKWGVTQVFRNEKHCR
NCFYPTLNVSSVPGLSVNAPISTMFCDFTNDPFPWLNDQENTSVQVFGFRMTGVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNGDVDGSSKTTTGGFSFQVDSR
VLREVLVHIVTEVMVLFMVLVYTGSQITPTALVATFLVPHDIPPVASQSALFDPACTVKKARVVCLPVSLLQLIAQHSHSPHCTVSIVLQAPHFVMKPNDKLVRISIFSI
QCLDMYGIQSEWREGYCVLGEKTSWHDVHCICKNIVRARRQLGTVGLTNIHLHTHYVMAKVIVIPNPVDLRLNIIKSLHRNPVTLFTVLSIILLYVILAFWALYRDEIDE
HLRGHVIVLPDNDPYDNLCYLVTIFTGSRWGSGTRANVFVQLRGTVSTSDVHCLSHPHFTTLYRGSINTFLLTTKSDLGDIHSIRVWHNNEGHSPSWYLSRIKVENLFSR
HIWLFICQKWLSIDTTLDRTFHVTHPDEPLTRKDFFFIDVSSNLQKNHMWFSIFASVVAKTFNRLQRLSCCLAMLLSSLLCNIMFFNLNRQEQTESRERRYMRSMMIGIE
SVLITIPVQLLITFLFTYSQRKPQADLKEVSPQKHPLMSEASEHWEECLTKWHAYETAKAHPREVAKPASKGKPRLPKASPKATSKPKHRHRKAQIKTAETPRPNTNSNN
NIEDNQDVHSEEHPSQQVLQQLKKKPRIVLPWWCVYVAWFLVFATSSISSFFIVFYGLTYGYDKSMEWLFASFCSFCQSVFLVQPSKIILLSGFRTNKLKYCKNLSWSTK
YKYTEIRLDGMRMHPEEMQRIHDQIVRIRGTRMYQPLTEDEIRIFKRKKRIKRRALLFLSYILTHFIFLALLLILIVLLRHTDSFYYNQFIRDRFSMDLANVTKLEDIYR
WLNSVLLPLLHNDLNPTFLPESSSKILGLPLMRQVRAKSSEKMCLPAEKFVQNSIRREIHCHPKYGIDPEDTKNYSGFWNEVDKQAIDESTNGFTYKPQGKQWLYYSYGL
LHTYGSGGYALYFFPKQQQFNSTLRLKELQESNWLDEKTWAVVLELTTFNPDVNLFCSISVIFEVSQLGVVNTSISLHSFSLADFDRKTSAEIYLYVAILIFFLAYVVDE
GYIIMQERASYVRSVYNLLNFALKCIFTVLIVLFLRKHFLATGIIQFYLSNPEDFIPFHAVSQVDHIMRIILGFLLFLTILKTLRYSRFFYDVRLAQRAIQAALPGICHM
AFVVSVYFFVYMAFGYLVFGQHEWNYSNLVHSTQTVFSYCVSAFQNTEFSNNRILGVLFLSSFMLVMICVLINLFQAVILSAYEEMKQPVYEEPSDEVEAMTYLCRKLRT
MFSFLTSQSKAKDEPEFFTDMLYGQPEKNSRRYLGLKTRNINGKKMVYLVV*
26 >lcl|XP_001110931.1|Plus1complement(4233778..4233984) NW_001111355 copper transport protein ATOX1-like LOC712361 __SEG__ Chr20 {Macaca mulatta} MPKHVFSVDVTCGSCAETVSRVLDKLGGVKYDTDLPNKEICIESEHSVDTLLAALKKTGKTVSYLGLE*
27 >lcl|XP_001113350.1|Plus1complement(10440683..10441801) NW_001100395 ATP-sensitive inward rectifier potassium channel 1 isoform 2 KCNJ1 __SEG__ Chr14 {Macaca mulatta} MFKRLRKWVVTRFFGPSRQRARLVSKDGRCNIEFGNVEAQSRFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSPNHTPCVENINGLT
SAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVVVNSFMCGAILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEG
ETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLIQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVE
VETPHCAMCLYNEKDARARMKRGYDNPNFILSEVNETDDTKM*
28 >lcl|XP_001115293.2|Plus1complement(4470324..4471463) NW_001108960 ATP-sensitive inward rectifier potassium channel 10 KCNJ10 __SEG__ Chr1 {Macaca mulatta} MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVV
QVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQT
HQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLF
DQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV*
29 >lcl|XP_001115566.1|Plus1complement(364..594) NW_001123343 voltage-dependent anion-selective channel protein 3-like LOC720287 __SEG__ Chr8 {Macaca mulatta} KKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHV*
30 >lcl|XP_001117781.2|Plus1complement(893..1597) NW_001122295 transient receptor potential cation channel subfamily M member 7-like LOC721594 __SEG__ Chr7 {Macaca mulatta} MCIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKVHNEITRELSISKHLAQNLIDDGPVRPSVWKKHSVVNTLSSSVPQGDLESNNPFLCN
ILMKDDKDPQCNIFGQDLPAIPQRKEFNFPEAGSSSGALFPSAGSPPELRQRLHGVELLKIFNKNQKLGSSSNSIPHLSSPPTKFFVSTPSQPSCKSHLETGTKDQETVC
SKAAEGDNIEFGAFV
31 >lcl|XP_001118483.1|Plus1<995..1426 NW_001108041 intermediate conductance calcium-activated potassium channel protein 4-like LOC722322 __SEG__ Chr19 {Macaca mulatta} LFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPMRGPPCAQDLGAPVTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFV
AKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAER*
32 >lcl|XP_001118659.1|Plus1complement(932..1306) NW_001108179 sodium/calcium exchanger 2-like LOC722521 __SEG__ Chr19 {Macaca mulatta} TFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVYWAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFLGLWLLYI
LFASLEAYCHIRGF*
33 >lcl|XP_001118693.2|Plus1<4..>645 NW_001108227 glutamate [NMDA] receptor subunit epsilon-4-like LOC722563 __SEG__ Chr19 {Macaca mulatta} AAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYPYAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPRHLSCSHDGLDGGWW
APPPPPWAAGPPPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGWDLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTAS
34 >lcl|XP_001118738.2|Plus1<6..>548 NW_001108266 potassium voltage-gated channel subfamily A member 7-like LOC722615 __SEG__ Chr19 {Macaca mulatta} CPPPCGCCERLVLNVAGLRFETRARTLGRFPDTLLGDPARRGRFYDDARREYFFDRHRPSFDAVLYYYQSGGRLRRPAHVPLDVFLEEVAFYGLGAAALARLREDEGCPV
PPERPLPRRAFARQLWLLFEFPESSQAARVLAVVSVLVILVSIVVFCLETLPDFRDDRDGPGLAAVAAAGP
35 >lcl|XP_002798481.1|Plus1complement(746..>1684) NW_001096316 inward rectifier potassium channel 4-like LOC721015 __SEG__ Chr10 {Macaca mulatta} TIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLN
VGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYDVAGTPCCSAREL
QESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI*
36 >lcl|XP_002799272.1|Plus116293871..16294398 NW_001099000 ferritin light chain-like LOC718777 __SEG__ Chr13 {Macaca mulatta} MSSQIRQNYSTDVEAAVNSLVNMYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDVKKPAEDEWGKTPDAMKAAMALEKKLNQA
LLDLHALGSAHTDPHLCDPLETHFLDEEVKLIKKMGDHLTNLNRLAGPEAGLGEYLFERLTLKHD*
37 >lcl|XP_002802741.1|Plus1complement(1935204..1935731) NW_001112544 ferritin light chain-like LOC100427851 __SEG__ Chr2 {Macaca mulatta} MSSQIRQNYSTDVEAAVNSLVNMYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDVKKPAEDEWGKTPDAMKAAMALEKKLIQA
LLDLHALGSAHTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLNRLAGPEAGLGEYLFERLTLKHD*
38 >lcl|XP_002803008.1|Plus15073193..5073744 NW_001112571 ferritin heavy chain-like LOC100424314 __SEG__ Chr2 {Macaca mulatta} MTTASTSQVRQNYHQDSEAASNRQINLERYASYLYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQGGGRIFLQDIKKPDYDDWESGLNAMECALHLERN
VNPSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLCKMGAPESGLAEYLFDKHTLGDSDNES*
39 >lcl|XP_002803173.1|Plus1complement(196789..197916) NW_001114167 ATP-sensitive inward rectifier potassium channel 15-like KCNJ15 __SEG__ Chr3 {Macaca mulatta} MDAIHISMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMK
VDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTH
VTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQF
EQIRKSPDCTFYCADSEKQKLEEKYRQEDQRERELRTLLLQQSNV*
40 >lcl|XP_002806239.1|Plus1complement(122577..>123239) NW_001218110 ferritin light chain-like LOC100430201 __SEG__ ChrX {Macaca mulatta} LSPPSNPASPLTTSVTICSTISGFWDQPKLLSLVPGCPPTMSTQSRQKYTAGVEAAIDRLINMHLQASYTYLSLSFYFEGDDVALKGVGHFFRKLAEERCESAKHLLVQN
QRSSCGLFQGEQKLLRDEWSGSLAAIEATLALENLNQPFLDLHTLGSANTDPSLCDFLEKHFLDREVKLIKKMGDYLTNRRRLASPQARLAEYLFRRLKDDWELPEPSNF
*
41 >lcl|XP_002806433.1|Plus12442480..2443031 NW_001218184 ferritin heavy chain-like LOC699053 __SEG__ ChrX {Macaca mulatta} MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDYDDWESGLNAMECALHLEKN
VNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES*
42 >lcl|XP_002806508.1|Plus11541..2212 NW_001218403 putative ferritin heavy polypeptide-like 19-like LOC714149 __SEG__ ChrX {Macaca mulatta} MVVLRGPRRRRHCPCRYRYTLRAPGDPTAFPLLLPAPALPALDPLSQVQRYHHPSCEAAVNTHITLELHASYVYLSMASYFEEDDSALEHFDRYFLRQSQEKREHVQELM
RLHNLRGGRICLHDIRKPERQGWESGLEAMECAFHLEKNINKSLLELHQLAKQNGDPHLCNFLENHFLNQQAKTIKELGGYLSNLRKMGAPPAAGLAEYLFDKLTLGRSE
KDT*