SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom P    

ID / Description / Sequence
1 >lcl|XP_001362177.1|Plus11005335..1006813 NW_001581848 potassium voltage-gated channel subfamily S member 3 KCNS3 __SEG__ Chr1 {Monodelphis domestica} MVFGEFFHTPGQEEELVNLNVGGFRQSVGQSTLLRFPHTRLGRLLTCHSEEAILELCDDYSVAEKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINE
LFIDSCCSNRYQERKDDNPNKDWDQKSNDGSTDSSFEESSIFEKELEKFDTMRFGNLRKKIWIRMENPASCLSAKLIAISSLSVVLASIVAMCVHSMAEFQKTEDGVENP
VLEAVEITCIIWFTGELAIRLVAAPCQKKFWKSPLNIIDFVSIIPFYATLAVDTKNEDSEDIENVGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLF
LSVGISIFSVLVYSVEKDDAQSGLTSIPICWWWATISMTTVGYGDTHPVTLVGKLLGSTCIICGILVVALPITIIFNKFSKYYQRQKDVDVDHGSSDEAPEGCNELPYFN
IRDIYAKRVHSFISSLSSAGIVASEQDATDASSIDEAEDIYDTVSLENDTAK*
2 >lcl|XP_001363139.1|Plus1complement(4135917..4137044) NW_001581956 ATP-sensitive inward rectifier potassium channel 15-like LOC100011565 __SEG__ Chr4 {Monodelphis domestica} METIHMNMSSPPLGNHTTNSELKAKRPRVMSKNGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVVTWFLFGVIYYVIAFIHGDLEQSEHSPNQTACIMK
VNSLTGAFLFSLESQTTIGYGVRFITEECPHAIFLLVIQLVVTTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKHNGKLCLVIQVANMRKSLLIQCQLSGKLLKTH
LTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTSQNLKEKDFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQF
EEIRRSSDSTFYCVDPEKQKLEMKYRQEEQRERELRTMLLQQNNI*
3 >lcl|XP_001363975.1|Plus1complement(6982369..6983661) NW_001581978 ATP-sensitive inward rectifier potassium channel 12-like LOC100012029 __SEG__ Chr6 {Monodelphis domestica} MTAGRVNPYSIVSSEEDGLHLATMPGANGFGNGKIHTRRKCRNRFVKKNGQCNIEFANMDDKSQRYLADMFTTCVDIRWRYMLLIFSLAFLVSWLLFGVIFWVIAIVHGD
LERSPDERNYKPCILQVHGFMAAFLFSIETQTTIGYGLRCVTEECPIAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRK
SHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEESPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPV
LFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPNTNSFCYENELAFMSRDEDDEEDDDSRGLDDLSPENRHEFDRLQATIALDQRSYRRESEI*
4 >lcl|XP_001365609.1|Plus1complement(13532144..13534297) NW_001581956 sodium/myo-inositol cotransporter-like LOC100015565 __SEG__ Chr4 {Monodelphis domestica} MRAVLETADIAIVALYFVLVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALMLLQLLGWVFIPVYIRSGVYTMP
EYLSKRFGGHRIQVYFAALSLLLYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIAMTALLTVTGGLVAVIYTDTLQALLMIVGALTLMVISMMKVGGFEEVKKRYMLA
KPNETSILLTYNLSNTNSCHVHPKPDALKMLREPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFADDLAC
INPEHCMRVCGSRAGCSNIAYPRLVMNLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKTASSRELMIVGRVFVAFMVVISIAWVPIIVEMQGGQMYLY
IQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFILGALRLILAFTYRAPECDQPDERPAFIKNIHYMYVATALFWITGLITVVVSLLTPPPTKEQVHTTTFWSVK
VPGRKESLPREDPYKMQEKSILKCSENLEGTSPVVPNGKSEESIKNMQPEDVTLLMTCKEESNTVSSLSHSEAETPVDSYSNGQAALMGDRKQEKEVDSRHQYWKFIDWF
CGFKSKSLNKRSLRDVMEEEALCLQMLEEPPKVKLILNIGLFAVCSLGIFMFVYFSL*
5 >lcl|XP_001366819.1|Plus154585540..54586739 NW_001581970 ATP-sensitive inward rectifier potassium channel 11-like LOC100020213 __SEG__ Chr5 {Monodelphis domestica} MLSRKGIIPEEYVLTRLAEDPTEPRYHARERRARFVAKNGNCNVAHKNIREQGRFLQDVFTTLVDLKWHHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLDHSTRGETDA
TFIPCVTSIHSFASAFLFSIEVQVTIGFGGRMVTEECPLAVLVLIVQNIVGLMVNAIMLGCIFMKTAQAHRRAETLIFSKHAVIAMRHGRLCFMLRVGDLRKSMIISATI
RMQVVRKTTSPEGEIVPLHQVDIPMENGVGGNSIFLVAPLIIYHIIDANSPLYDLAPGDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGR
YSVDYSKFGNTIKVPTPACTARQLEEDRTLLDSLPLASPKGPLRKRSLASAKSKPQHKPRFSISLDALS*
6 >lcl|XP_001367763.1|Plus1complement(14139043..14139759) NW_001581970 extracellular superoxide dismutase [Cu-Zn]-like LOC100013366 __SEG__ Chr5 {Monodelphis domestica} MLPVLSATIILSAFVSCATVELNGEQMNDIQKKVSDLWHRLIYLKPVTSGSDDHIVYATCQVQPSSTLEANKPQVTGQVLFKQLYPDGKMEVFFDLQGFPADTRNATGRA
IHIHNFGDLSNGCDSTSSHYNPHGVAHPLHPGDFGNFLVKDGKIRKSRSNVSASLFGPHSVLGRAIVVHEQEDDLGKGGNKGSLEHGNAGKRLACCVIGICGPELWNKAA
MDNASRKKKRRESECKTA*
7 >lcl|XP_001368338.2|Plus112335190..12336818 NW_001582018 potassium voltage-gated channel subfamily A member 6-like LOC100013991 __SEG__ Chr8 {Monodelphis domestica} MREETTLALAARGEVRGPEEEQQGGGDFPGSAGGGGGCCSSERLVINISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRP
VNVPLDIFLEEIRFYQLGEEALEAFREDEGCLPEGGEHQKPLPSQPFKRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRPDPRSRSDGGRVSSGGPAS
RGSQEEDEGDHSVYKLLNPSVIVQGGVVSGPGPSNQLIPLGGPTESASFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIIDLVAIFPYFITLGTELVQQQ
EQQPGSTGGGSSQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFSSIPDAFWWAVVTMTTVGYGD
MYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPVPDLKGVGGGLGKPDFSEVAPERRPSYLSTPHRAYAEKRMLTEV*
8 >lcl|XP_001368375.2|Plus112467983..12469467 NW_001582018 potassium voltage-gated channel subfamily A member 1-like LOC100014025 __SEG__ Chr8 {Monodelphis domestica} MTVMSGENVEEASAAQGHPQDISYPRPADHDDHDCCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPL
DMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKEDREFSTFRQSDNTTIYYKSNIFTDPF
FIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEMAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIF
FLFIGVILFSSAVYFAEAEDADSHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSSPNLASDSDL
SRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTANQNCVNKSKLLTDV*
9 >lcl|XP_001368410.1|Plus112653866..12655695 NW_001582018 potassium voltage-gated channel subfamily A member 5-like LOC100014073 __SEG__ Chr8 {Monodelphis domestica} MEIALVTLKNGGTVAIGKGEPTGGNSGPKPEGEVRRPPTGQPNDGAKEGTPRRSRSGGGGRGEVLSGRPLPELPETARQQTPGQGEEEAETSSPLGMSEGEGLGSSALHH
QRVLINISGLRFETQLGTLAQFPDTLLGDPAKRLHYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPR
NEFQRQVWLIFEYPESSGSARGIAIVSVLVILISIITFCLETLPEFRDERELFRHPQLPQQPPTHPQNANASRGGGRNLHLLSQGPTVAPMVSRTLADPFFIVETTCVVW
FTFELLVRFFACPSKAEFSRNIMNIIDVVAIFPYFITLGTELAEQQPGGIGGGGGSNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLF
IGVILFSSAVYFAEADNHETHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDNEERAALKEEPTSTTGQGSGQDSV
NQMKSSESKGSFTKTPDNMEGSHRGSCPLEKCNLKAKSNVDIRKSLYALCLDTSQETDL*
10 >lcl|XP_001369106.1|Plus1110335856..110337289 NW_001581902 potassium voltage-gated channel subfamily S member 2 KCNS2 __SEG__ Chr3 {Monodelphis domestica} MTGQSLSDLSEANFEDSEISVNVGGFKKKLRSHTLLRFPETRLGRLLHCRSKESILELCDDYDDAQNEFYFDRNPELFPYVLHFYNTGKLHVMGELCVFSFSQEIEYWGI
NEFFIDSCCSYSYHGRKMEPDQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNLRRQLWLALDNPGYSILSRVFSILSIMVVLGSIVTMCLNSLPDFLIPDSQGN
PEEDPRFEIVEHFGIAWFTFELVARFAVTPEFFKFFKNALNLIDLMSIIPFYITLVVNLVVESSPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVG
LLLLYLSVGISIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVP
SVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLH*
11 >lcl|XP_001369750.1|Plus161597402..61598541 NW_001581871 ATP-sensitive inward rectifier potassium channel 10-like LOC100023256 __SEG__ Chr2 {Monodelphis domestica} MTSVAKVYYSQTTQTESRPLMGPGLRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVV
QVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVATHDGKPCLMIRVANMRKSLLIGCQVTGKLLQT
HLTKEGESIRLNQVNVAFQVDTASDSPFLILPLTFYHVVDDSSPLRDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLF
DQVVKVTPPGGLRDTTVRYGDPEKLKLEESFREQEGKEGSALSVRISNV*
12 >lcl|XP_001370083.1|Plus1complement(29630184..29631467) NW_001581875 inward rectifier potassium channel 2-like LOC100024208 __SEG__ Chr2 {Monodelphis domestica} MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLH
GDLDAPDDNKACVSQVSSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVVAMRDGKLCLMWRVGNLRKS
HLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLNKQDMDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVL
FEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGLPESTSTDTPPDIDHHNQAGVPLEPRPLRRESEI*
13 >lcl|XP_001371864.1|Plus1complement(63048642..63050117) NW_001581841 potassium voltage-gated channel subfamily F member 1 KCNF1 __SEG__ Chr1 {Monodelphis domestica} MNVAGDSSLLELDSNGSESTEDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEIHMKKGICPICFK
NEMEFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDASENRWKRCQKCIWKFMEKPESSCPARIVAILSFLLILISSVVMCMGTIPELQILDDEGNHVEHP
TLDNIETACIGWFTLEYVLRLISSPNKLHFALSFMNIIDVLAILPFYVSLTLTHFGARMMELTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMY
LAVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLETAAKHELELMELNSSEGRAG
GSRSDLDNPQAQQEGKEVPLWSSRLKVSHSDTFIPLLSDEKHYRTRLQSCK*
14 >lcl|XP_001372701.1|Plus1complement(194390667..194392166) NW_001581879 potassium voltage-gated channel subfamily A member 2-like LOC100030287 __SEG__ Chr2 {Monodelphis domestica} MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFS
EEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMPGGGIPFHTYSNSTIGYQQSTSFTD
PFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKTDDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGL
LIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPS
SPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV*
15 >lcl|XP_001374220.1|Plus19131916..9132542 NW_001581881 amiloride-sensitive cation channel 1, neuronal-like LOC100022343 __SEG__ Chr2 {Monodelphis domestica} MDLKDSTSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWALAFMGSLGLLLVESSERISFYLTYQHVTKVDEVVAHSLAFPAVTFCNLNGFRFSRLTTNDLYHA
GELLALLDVNMNIPNPHLADPTVLEALREKANFKHYKPKVFSMREFLERVGHDLKDMMLYCKFKGQECDHQDFTTVSNLVFSSLWAFHSWPRRALGEL*
16 >lcl|XP_001374416.1|Plus1complement(365747..367075) NW_001587030 p3 protein-like LOC100022624 __SEG__ ChrX {Monodelphis domestica} MLLFASLLSGLLCGVQGEPISKTHLPSSSYLSIGEDSVLEFEFPERTKGIIVVSSRYPGQNNKTVSEPVLSVTSLDTEVLSIKNVTAQSWDNSHFVVSIQSGLAGLAPLH
IQLLDLQRDPMLIEERLDFLIKVSPVDNDEDDDARQGGLGRFSESPIVYMLLPLVFVNKCAFGCKVELEGLKGLIKSPHPMLLGIVGQFLLMPLYGFLMAKVFTLPKALA
LGLIITCSTPGGGGSYLFSLLLGGDVTLAISMTLISTVAATGFMPLSSAIYGRLLSVHETLHIPFSKILLTLLFIAIPISTGMVIKYKMPKVSRILLKVIKPFSVVLILG
GLFLACRMGALILADVRLPIVLAGLTVPLAGLLVGHALAACLKLSVPYQRTVSFEVGIQNSLLALAVLQLSFRHLQADQASQAPFIVALSSTSEMLALVIGHLAYNSLYS
TT*
17 >lcl|XP_001378872.2|Plus1complement(29685335..29686603) NW_001581875 inward rectifier potassium channel 16-like LOC100028988 __SEG__ Chr2 {Monodelphis domestica} MSYYGSNYRIVNMEGNVPKYTNYHPEHIITEKRRARRRLLHKDGSCNVYFKHIFGEWGSYMVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGLIFWVIALHHGDLINDPN
ITPCVDNVHTFTGAFLFSLETQTTIGYGSRCVTEECSVAVLVVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVR
AQLLRYVEDSERRMTMGFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFTYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKKKYYKVNCLQ
FEGSVEVYAPFCSAKQLDWKDQQLHNLEKTTSGKGSGMTETKVRRRSFSAIAIVSSSENPDEMTKTTADESNETTYQKALLQLNRISVESQM*
18 >lcl|XP_001380892.2|Plus116796715..16798229 NW_001581894 LOW QUALITY PROTEIN: alkaline phosphatase, tissue-nonspecific isozyme ALPL __SEG__ Chr3 {Monodelphis domestica} MLLLFLSLLAGACLSSLVQEKNPEYWRAQAQQTLHKALELQKLNTNVAKNVILFVGDGMGVTTVSAARILKGQLHHMPGEEFQLEMEKFPFLALSKTYNTNAQVPDSAGT
ATAFLCGVKSKKGTLGVSAAASRSQCNTTKGNEITSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSVDRTWYSDNEMPSEALGQGCKDIAHQLMHNIPDIEVVLGGGR
KYMFPKGTPDVEYGNKEARGTRLDGQRLTDIWREKKPPNKNAYYVWNRRQLLKLDWNHVDFLLGLFEPKDMMYELNRNRWTDPSLTEMVEVAIKILRKNPEGFFLLVEGG
RIDHGHHAGKAKQALHEVVEMDRAIARAGALTSSEDTLTVVTADHSHVFTLGGHAPRGNSIFGLATSLSDRDKKPFTSLLYGNGPGYKVVAGERENVLAVDYADKNYRAQ
AAVPLSKETHGSEDVPVFSKGPMAHLLHGVFEQNYIPHAMAYASCIGSNTDHCQPHS*SQLAAC*
19 >lcl|XP_001381949.2|Plus1complement(115041439..115044738) NW_001581841 plasma membrane calcium-transporting ATPase 3-like LOC100033060 __SEG__ Chr1 {Monodelphis domestica} MAYKSPSGPSPARAGSASLSQLQERLLQVSLKDLGQLMRLRGLEALEQLEAHFGGVSGLCLLLQTNPEFGLPLDPVELSRRREQFGTNEVPKPRGKYFLELVWDSLQDTT
LIFLEVAAVLSLAVAFYELKINRETKGCDVGGVVAGSEKEAEDELVRWLEGTVLLISVALVVLATALSDWNKEKQFRNLEDRVVQSQKGKVFRNGQILEVPVKDIVVGDV
VPVSYGDMLPADGVLLHGLNLKMDESSLTGELNMVNKSLDRDPILLSGTYVREGWGKIIVTAVGPNSQTGIILTLLDASAQQGNLEAQRKAQQWESHCKSILKLKHSYSK
EKLVLQKKLSKLAVLITKCSMLMASITVVTLVTHFVINTFVIEGQKWTLDCTSVYTRYFIKFFIIGITILVVSIPEGLPLAVTLSLAYWVKRMMKDNNLVRHLDVYESVR
NATTICLDKTGTLTMNRMTVVQAYIGENHYQRLPKTNSIPDPILEYLLKGITINCSYTSNVILPKGGQKSVQQIGNKTECALLGFLLHLDLDYETERNKIPQQSLYKVYT
FNSDRKYMSTVLKLSSGGFLMFSKGRSEIVLEKCCKILDKMGEPVELTETKKEEIFHNIIEPMTSEGLQTICLAFREFSDQEMEPDWDREEDIITELTCIALVGIEDPVR
PEVPSAIKECQQAGITVRMVTGDNLNTARAIAFKCGILNLHDNYLSLEGRDFNRLIRNKYGKIEQTLLDKIWPRLRVLASSSPSDKYALVKGIIDSDVLGVRQIVAVTGD
GTNDGPVLKVADVGFALGIIGTDIAREASDIILMDENFTSIMKAIMCGRSIYDNISKFLQFQLTLSIVATTVAFIGACVTQDSPFKAVQMLWINLIMDTFASLALVTEKP
TKTLLLRDFPEKKQHLLSSSMVKYILGHAVYQLTVTFVLMFVGEELFGFESGRKALLHASPSTHYTMIFNTFVMMQLFNEINARKIHGERNVLEGMRSNNFFCIIVGGTF
AFQFLIVQFGGNIFCCTSLSPDLWLWCIFLGAGILVWGQFVTNIPNKCVEPLIRLMGGRSEEKVETICPTISMTEDLWWVQNPSRIQNQKRLIKTYHSYFRRSLSQILH*
20 >lcl|XP_001381980.2|Plus1complement(194213189..194214727) NW_001581879 potassium voltage-gated channel subfamily A member 10-like LOC100033096 __SEG__ Chr2 {Monodelphis domestica} MDVSGWKEMEVALVNFDNSDEVLEESGYPADFDLASLKGRPSCSSHLSNWRVLTNDGTNHETIFCKLPGDYSDPQASEPVAMNEGNQRVIINIAGLRFETQLKTLNQFPE
TLLGDREKRVQFFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEISFYELGVEAMDQFREDEGFIKDPKTQLPKNDFHRQFWLLFEYPESSSAARGVA
VVSVLVVVISITIFCLETLPEFREERELKVVRDPSLNLSKTVLSHNMFTDPFFMVESTCIIWFTFELVLRFVVCPSKTGFFRNIMNIIDIISIIPYFVTLITELVQETEP
SAQQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGT
LCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGETDKLLASVISGMGSTDSLNKTNGGCSREKSRK*
21 >lcl|XP_001381982.2|Plus1complement(194521576..194523345) NW_001581879 potassium voltage-gated channel subfamily A member 3-like LOC100033099 __SEG__ Chr2 {Monodelphis domestica} MDEHLSLLHSPPPPSARHRAHPSAQPQPQPQSGGGGGGGAHTLVNPGYIEAAAGAAAGPELHPGMTVVPGDHLLEPEASGPQPGGCGGGCDRDRYEPLPPGGPPAGAVAG
AEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLRE
EERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPAPLSPETLEATNNGTSGSQAGVSSFSDPFFVVETLCIIWFSFELLVRFFA
CPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSS
GFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSVEELRKARSNSTLSKSEYMVIEEAG
MNHSTFPPAPFKTGNSTATCTTNNNPNSCVNIKKIFTDV*
22 >lcl|XP_003341499.1|Plus1<50722605..50723039 NW_001581970 ferritin heavy chain-like LOC100027643 __SEG__ Chr5 {Monodelphis domestica} GNLDRDHVALKNFAKYFLHQSHEEREHAEKLMKLQNQRVSRIFLQDIKKPDRDNWESGLNAMECALHLEKNVNQSLLELHKLETDKNDPHLCDFIETHYLDEQVKSIKQL
DDHVTNLRKMEAPDSGMAEYIFDKHTLGDSDNRS*