SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab P    

ID / Description / Sequence
1 >lcl|NP_001093883.1|Plus19669037..9669585 NW_001867368 ferritin heavy chain FTH1 __SEG__ Chr12 {Equus caballus} MTTAFPSQVRQNYHQDSEAAINRQINLELHASYVYLSMSFYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPGQDDWENGLKAMECALHLEKN
VNESLLELHKLATDKNDPHLCDFLETHYLNEQVKAIKELGDHVTNLRRMGAPESGMAEYLFDKHTLGECDES*
2 >lcl|XP_001487881.1|Plus1complement(62789985..62790635) NW_001867377 superoxide dismutase [Mn], mitochondrial-like LOC100049796 __SEG__ Chr14 {Equus caballus} MLCRAECSTSRKLVPALGSQQKHSLPDLQYDYGTLEPYINAQIMQLHHSKHHAAYVNNLNVTKEKYKEALAKGDVTAQTALQPALKFNGGGHINHTIFWTNLSPNGGGEP
KGQLRDANFGSFDKFKQKLTAVSAGVQGSGWGWLGFNKDQGRLQIVACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSERYMACKK*
3 >lcl|XP_001488276.2|Plus1complement(29721849..29722397) NW_001877040 ferritin heavy chain-like LOC100049869 __SEG__ ChrX {Equus caballus} MATAQPSQVLQNYHPDCEAAINGQICLELYTSYMYLSMACYFDRADVALKHFFQLFLQQSRQKREHAERLMQLQNQRGGRLHLGDIKKPDPDHWESSLKAVECALQLEMN
VNQSLLDLHQLATDKADPHLCHFLESHLLLEEVKSMKELGDHLTSLLKMGAPADGLAEYLFDKLTLGDGSKN*
4 >lcl|XP_001488825.1|Plus1complement(31058883..31059410) NW_001877040 ferritin light chain-like LOC100055696 __SEG__ ChrX {Equus caballus} MGTRIRQTYCANVEAAVNSLVNLHLRASQTYLSLGFYFEGDDVAVEGVGHFFRKLAEEKREGAQRLLKFQNQWSSLALVQDGEKSSQDQWSGSVDAMEAALVLEKKVNEG
ILDLHALGSANADPHLCEFLKSHFLEEEMKVIKKMGDHLTNLRRLAGPEAGLGEYLFRRLTHKHN*
5 >lcl|XP_001489239.3|Plus129955151..29955705 NW_001877040 ferritin heavy chain-like LOC100054635 __SEG__ ChrX {Equus caballus} MMTTQLSQVHQHYHLDCEAAVSIQMNLELYASYVYLSVGYYFDGDDVALKPFSHFFLQLSCEEREHAHRLTQLQNLHGGRLCLRLHNIGNPDQDDWESGLEVMKCTLHLE
KCISQSLLDLYQLATDKNDAHLCDFLANHHLKEQVKSMKELGGHITNPHKMGAPEDGMAEYLFDKLTLGDGNKN*
6 >lcl|XP_001489329.1|Plus110019042..10019965 NW_001867418 zinc transporter 1-like LOC100054805 __SEG__ Chr5 {Equus caballus} MQNFHFFVDPEKSRNDATEVQVNGNLIREPDLVELEDDDKAGQLNMRGVFLHVFGDALGSVIVVVNALVFYFSWKRCPEGEFCVNPCTPDPCKAFVEIINGTHATVYEAG
PCWVLYLDPTLCIVMVCILLYTTYPLLKESALILLQTVPKQIDIKNLIKELRNVEGVEEVHELHVWQLAGSRIIATAHIKCEDPASYMQVAKIIKDVFHNHGIHATTIQP
EFASVGSKSSVVPCELACRTQCALKQCCGTRPQAHSGKDAEKAPTVSISCLELSDNLEKPRRTKVESIPAVVIEIKKMPNKQPESSL*
7 >lcl|XP_001489651.1|Plus1complement(9713034..9713561) NW_001877040 ferritin light chain-like LOC100055401 __SEG__ ChrX {Equus caballus} MGTRIHQTYSAKVEAAVNRLVNLHVQASDTDLCLGFYCEGSNVTVEGLGHFFHEVAEEKREGAQRLLKSQNQWSSFALIQDRQKRSPDEWSGSVVAMEAAIVLEKNLNQA
VLDLHALGSVNTDPRLCDFLKSHFLEEKMKVIKKMGDHLTNLRRLTGPKARLGESLFRRLTHKHN*
8 >lcl|XP_001490709.1|Plus16281716..6283029 NW_001867432 sodium/bile acid cotransporter 5 SLC10A5 __SEG__ Chr9 {Equus caballus} MSRKLFIVLLLLFVTLGEARKSFLSFLTIEKTEILFFTKTEETIIVRSSYKDKWPNSSYLFVQLEDPKMLRVVNVTKTLSDVTNFTINLVTDEVGETNLTIQLWDSEGRQ
ERLIEEIKNVKVKVLRQRKDDLFQASMRIDRNILMIFLPLILLNKCAFGCKIELEVFQTVWKKPLPIILGAVTQFFLMPFCGFLLTQILALPEAQAFGFIMTCTCPGGGG
GYLFALLVEGDITLAILMTCTSTLLALIMMPANSYIYSRMLGLSGTFHIPVSKITSTLLFILIPISAGIVIKRRKPEKAKLLERIIRPLSFILMSVGIYMTFRIGLMFLK
TVSLEVLLLGALVPTLGLSFGYSFATISMLPLPVCKTVAIESGILNSFLALAIIQLSFSQSKANLASVAPFTVAMCSGCEMLVILLVYKARKTWILIEDKRKNIPLA*
9 >lcl|XP_001491261.2|Plus1786579..787718 NW_001867419 ATP-sensitive inward rectifier potassium channel 10 KCNJ10 __SEG__ Chr5 {Equus caballus} MTSVAKVYYSQTTQTETRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVV
QVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAAHNGKPCLMIRVANMRKSLLIGCQVTGKLLQT
HQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLF
DQVVKVAPPSGLRDSTVRYGDPEKLRLEESLREQAEKEGSALSVRISNV*
10 >lcl|XP_001492521.1|Plus18743059..8743586 NW_001867387 ferritin light chain-like LOC100050801 __SEG__ Chr1 {Equus caballus} MSSHIRQNYSTEVEAAINRLVNLYLRASYTYLSLGFYFNRDDVALEGVCHFFCELAEEKRECAKCLLKMQNQHGDHALFQDLQKPSQDEWGTTLDAMKAAVVLEKSLNQA
LLDLHALGSAHADPHLCDFLESHFLDEEVKLIKKMGDNLTNIQRLVGPQAGLGECLFERLTLKHD*
11 >lcl|XP_001494777.1|Plus15474630..5476222 NW_001867423 potassium voltage-gated channel subfamily A member 6 KCNA6 __SEG__ Chr6 {Equus caballus} MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGLCSSERLVINISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPV
NVPLDIFLEEIRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRADGRGGSNGGGVSRVSPVSR
GSQEEEEEEDDSYAFHPGITPGGMVPGGSSSLSTFGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIIDLVAIFPYFITLGTELVQQQEQQSASGGGG
QNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVG
SLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPTPDLKAADNGLGKPEFSEGPRERRPSYLPTPHRVYAEKRMLTEV*
12 >lcl|XP_001495023.1|Plus15574345..5575832 NW_001867423 potassium voltage-gated channel subfamily A member 1 KCNA1 __SEG__ Chr6 {Equus caballus} MTVMSGENVDEASAAPGHPQDGIYPRPADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPL
DMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDEKDFTGTVRRIDNTTVIYSSNIFTDP
FFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI
FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSSPNLASDSD
LSRRSSSTVSKSEYMEIEEDLNNSIAHYRQANIRTANCTAANQNCVNKSKLLTDV*
13 >lcl|XP_001495044.1|Plus15700396..5702183 NW_001867423 potassium voltage-gated channel subfamily A member 5-like LOC100051720 __SEG__ Chr6 {Equus caballus} MEIALVPLENGSAMTVRGGGEARGGELQRPSTAGLSDGPKEPAPRGRGTQRSADPGGRPLPPLPQEPPQPRQPPEDEEGEGDPTLGMAEDHAPGAGSLHHQRVLINISGL
RFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLI
FEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPHQPPGAARGTNGSGAMAPPSGPTVAPLLPRTLADPFFIVETTCVVWFTFELLVRFFACPSK
AEFSRNIMNIIDVVAIFPYFITLGTELAEQQPGGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEAD
NQETHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAVLKEEQGSQSQGAGLDSRGQRKASWSKGSLCKARG
SLENADGARRGSCPLEKCNLKAKSNVDLRRSLYALCLDSSRETDL*
14 >lcl|XP_001495070.2|Plus1complement(1054981..1055682) NW_001867394 ferritin heavy chain-like LOC100062546 __SEG__ Chr23 {Equus caballus} MEPGARSPPRPATQSQPSSTSSQRPRPAARLPPPLQRRPAAAALSSPRPSAMTTAFPSQVRQNYHQDSEAAINRQINLELHASYVYLSMSFYFDRDDVALKNFAKYFLHQ
SHEEREHAEKLMKLQNQRGGRIFLQDIKKPDQDDWENGLKAMECALHLEKNVNESLLELHKLATDKNDPHLCDFLETHYLNEQVKAIKELGDHVTNLRRMGAPESGMAEY
LFDKHTLGECDES*
15 >lcl|XP_001495224.2|Plus134452787..34453914 NW_001867397 ATP-sensitive inward rectifier potassium channel 15 KCNJ15 __SEG__ Chr26 {Equus caballus} MDAMHINMSSAPLVKHTAGAGLKTNRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPSERISNHTPCIMK
VDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTH
VTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKTGKYVADFSQF
EQIRKSPDCTFYCADAEKQKLEEKYRQEDQRERELRTLLLQQSNV*
16 >lcl|XP_001496518.1|Plus18620215..8621714 NW_001867420 potassium voltage-gated channel subfamily A member 2-like LOC100058705 __SEG__ Chr5 {Equus caballus} MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFS
EEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTD
PFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGL
LIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPS
SPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV*
17 >lcl|XP_001497119.1|Plus130658873..30661029 NW_001867397 sodium/myo-inositol cotransporter-like LOC100052070 __SEG__ Chr26 {Equus caballus} MRAVLETADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMP
EYLSKRFGGHRIQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIVGALTLMIISMMEIGGFEEVKRRYMLA
SPNVTSILLTYNLSNTNSCNVHPKTDALKMLRNPTDEDVPWPGFVLGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFADDIAC
INPEHCMQVCGSRAGCSNIAYPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLY
IQEVADYLTPPVAALFLLSIFWKRCNEQGAFYGGMAGFILGAVRLTLAFAYRAPECDQPDNRPGFIKDIHYMYVATALFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKK
SVVVKESCSPKDEPYKMQEKSILRCSENSESINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGEKERKKETEDGSRYWKFIDW
FCGFKSKSLSKRSLRDLMEEEAVCLQMLEEPPQVKLILNIGLVAVCSLGIFMFVYFSL*
18 >lcl|XP_001498662.1|Plus1complement(9659875..9661158) NW_001867366 inward rectifier potassium channel 2-like isoform 1 LOC100052953 __SEG__ Chr11 {Equus caballus} MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFILSWLFFGCVFWLIALLH
GDLDASKESKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKS
HLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVL
FEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRPLRRESEI*
19 >lcl|XP_001503583.1|Plus1complement(79266862..79268346) NW_001867379 potassium voltage-gated channel subfamily F member 1 KCNF1 __SEG__ Chr15 {Equus caballus} MDGAGERSLPEPDSRGSRAGDDIEIVVNVGGVRQVLYGDLLSRYPETRLAELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFK
NEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDTAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILISSVVMCMGTIPELQVLDAEGNRVEHP
TLENVETACIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMY
LAVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLETAAKHELELMELNSSSAVEG
KAGGSRNDLDNLSPEAPGKEGPSWSSRLKISHSDTFIPLLTEEKHHRTRLQSCK*
20 >lcl|XP_001505002.1|Plus1complement(37508335..37509507) NW_001867427 ATP-sensitive inward rectifier potassium channel 11 KCNJ11 __SEG__ Chr7 {Equus caballus} MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKNGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPDEGSAVPC
VTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHSRLCFMLRVGDLRKSMIISATIRMQVV
RKTTSPEGEVVPLHQVEIPMENGVGGNSIFLVAPLIIYHAIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDY
SKFGNTIKVPTPLCTARQLDEDHSLLDALTLASARGPLRKRSVAVAKAKPKFSISPDSLS*
21 >lcl|XP_001914676.1|Plus126297..26845 NW_001877041 ferritin heavy chain-like LOC100146482 __SEG__ ChrX {Equus caballus} MTTAFPSQVRQNYHQDSEAAINRQINLELHASYVYLSMSFYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDQDDWENGLKAMECALHLEKN
VNESLLELHKLATDKNDPHLCDFLETHYLNEQVKAIKELGDHVTNLRRMGAPESGMAEYLFDKHTLGECDES*
22 >lcl|XP_001916676.1|Plus127441989..27442537 NW_001877040 ferritin heavy chain-like LOC100147315 __SEG__ ChrX {Equus caballus} MATAQPSQVLQNYHPDCEAAINGQICLELYASYVYMSMAYYFDRDDVALKHFFQLFLQQSRQKREHAERLMQLQIQRGGRICLHDIKKPDRNNWESRLKAVECVLQLEMN
VNQSLLDLHQLATDKADPHLCHFLESHLLLEEVKSMKELGDHLTNLLKMGAPADGLAEYLFDKLTLGDGSKN*
23 >lcl|XP_001916682.1|Plus127462089..27462637 NW_001877040 ferritin heavy chain-like LOC100147034 __SEG__ ChrX {Equus caballus} MATAQPSQVLQNYHPDCEAAINGQICLEFYASYVYMSMAYYFDRADVALKHFFQLFLQQSRQKGEHAERLMQLQTQRGGRLRLGDIKKPDRHNWESSLKAMECALHLEKC
VTQSLLDLHQLATDKADPHLCHFLESHLLLEQVKSMKELGDHLDNLHKMGAPADGLAEYLFDKLTLGDGSKN*
24 >lcl|XP_001916741.1|Plus1complement(29749962..29750510) NW_001877040 ferritin heavy chain-like LOC100049934 __SEG__ ChrX {Equus caballus} MATAQPSQVLQNYHPDCEAAINGQICLELYASYVYMSMAYYFDRDDVALKHFFQLFLQQSRQKREHAERLMQLQNQRGGRLRLGDIKKPDRDDWESGLKAVECALQLEKN
VNQSLLDLHQLATDKADPHLCHFLESHLLLEEVKSMKELGDHLTNLLKMGAPADGLAEYLFDKLTLGDGSKN*
25 >lcl|XP_001916764.1|Plus130130146..30130694 NW_001877040 ferritin heavy chain-like LOC100050000 __SEG__ ChrX {Equus caballus} MATAQPSQVLQNYHPDCEAAINGQICLELYTSYMYLSMACYFDRADVALKHFFQLFLQQSRQKREHAERLMQLQNQRGGRICLHDIKKPDRNNWESGLKAMECALQLEMN
VNQSLLDLHQLATDKADPHLCDFLESHLLLEQVKSMKELGDHLDNLRKMGAPADCLAEYLFDKLTLGDGSKN*
26 >lcl|XP_003362506.1|Plus160028787..60030076 NW_001867366 ATP-sensitive inward rectifier potassium channel 12-like LOC100147042 __SEG__ Chr11 {Equus caballus} MTAAGRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLADMFTTCVDVRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHG
DLEPPEGHGRTPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRK
SHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPV
LFEEKNQYKIDYSHFHKTYEVPSTPRCSARDLVENKFLLPSANSFCYENELAFLSRDEEDEADADQDGPSPQARHDFDRAQAGIGGTLEQRPYRRESEI*
27 >lcl|XP_003362572.1|Plus1complement(9696197..9697456) NW_001867366 inward rectifier potassium channel 16-like LOC100053003 __SEG__ Chr11 {Equus caballus} MSYYGSSYPIVNVDPKYPGYPPEHVIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLNDPDITP
CVDNVHSFTGAFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSSIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQL
LRYTEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDQESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKRKYYKVNCLQFEG
SVEVYAPFCSAKQLDWKDQQLHNMEKAPPVRSSSTSDTKVRRRSFSAVAIVSSCENPEETTTSATDECKEAPYQKALLTLNRISVESQM*
28 >lcl|XP_003365342.1|Plus1complement(37470509..37471627) NW_001867425 ATP-sensitive inward rectifier potassium channel 1 isoform 2 KCNJ1 __SEG__ Chr7 {Equus caballus} MFKHLRKWFVTCFFGHSRQRARLVSKDGRCNIEFGNVEAQSRFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFLFGLLWYAVAYIHKDLPEFHPSVNHTPCVENINGLT
SAFLFSLETQVTIGYGFRCVTEKCGTAIFLLIFQSILGVIVNSFMCGAILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEG
ETIILDQININFVVDAGNENLFFISPLTIYHVIDHTSPFFHMAAETLPQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVE
VETPHCAMCLYNEKDATARMKRGYDNPNFILSEVNETDDTKM*
29 >lcl|XP_003365818.1|Plus1complement(24456160..24456708) NW_001877040 ferritin heavy chain-like isoform 2 LOC100051588 __SEG__ ChrX {Equus caballus} MANPPPLRVRQNYHHDSEAAVNIQINLELHASYVYLSMAYYFNRDDVALKHFFQLFLKLSRRERERAERLMQLQNQRGGLIRFGDIKQPDRDDWESGLKAVECALHLEKS
VNQSLLDLYQLATNRNDAHLCHFLKSHCLKEQVKSIQELGDHLTSLRKVGVPEDGLAEYLFGKLSLGDSDKN*