SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam P    

ID / Description / Sequence
1 >lcl|NP_001003080.1|Plus130005284..30005835 NW_876253 ferritin heavy chain FTH1 __SEG__ Chr11 {Canis lupus familiaris} MTTASPSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWENGLNAMECALHLEKS
VNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMGAPESGMAEYLFDKHTLGNSDNES*
2 >lcl|NP_001003120.1|Plus17568499..7569782 NW_876331 inward rectifier potassium channel 2 KCNJ2 __SEG__ Chr9 {Canis lupus familiaris} MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLH
GDLDASKESKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKS
HLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVL
FEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDLDLHNQASVPLEPRPLRRESEI*
3 >lcl|NP_001003329.1|Plus123722640..23724139 NW_876321 potassium voltage-gated channel subfamily A member 2 KCNA2 __SEG__ Chr6 {Canis lupus familiaris} MTVATGEPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFS
EEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTD
PFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGL
LIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPS
SPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV*
4 >lcl|NP_001006646.1|Plus1complement(39838916..39840715) NW_876284 potassium voltage-gated channel subfamily A member 5 KCNA5 __SEG__ Chr27 {Canis lupus familiaris} MELALVPLENGGAMTVRGGGEARAGCGQAVGGELQCPPTAARGAGPKEREPRERGPPRGADPGARPLPALPLPRRLPPEDEEGDGDPALGLAEDQVPGPGSGSFHHQRVL
INISGLRFETQLGTLAQFPDTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGDEALERFREDEGFIKEEEKPLPRNEFQ
RQVWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPGPPHPPGPARGTNGSAALAPASGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRF
FACPSKAEFSRNIMNIIDVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVY
FAEADNQETHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGSQSQGTGLDSGGPRKTSWSKGSL
CKAGVSLENADGARRGSCPLEKCNLKAKSNVDLRRSLYALCLDTSRETDL
5 >lcl|NP_001182069.1|Plus128649336..28651492 NW_876295 sodium/myo-inositol cotransporter SLC5A3 __SEG__ Chr31 {Canis lupus familiaris} MRAVLETADIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMP
EYLSKRFGGHRIQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIVGALTLMIISMMEIGGFEEVKRRYMLA
SPNVTSILLTYNLSNTNSCNVHPKKDALKMLRNPTDEDVPWPGFVLGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFADDIAC
INPEHCMQVCGSRAGCSNIAYPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRRSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLY
IQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLTLAFAYRAPECDQPDNRPGFIKDIHYMYVATALFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKK
SLVVKESCSPKDEPYKMQEKSILRCSENSEATNHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGEKERKKETEDGGRYWKFIDW
FCGFKSKSLSKRSLRDLMEEEAVCLQMLEEPPQVKLILNIGLFAVCSLGIFMFVYFSL*
6 >lcl|NP_001229643.1|Plus112828884..12830206 NW_876313 ATP-sensitive inward rectifier potassium channel 12 KCNJ12 __SEG__ Chr5 {Canis lupus familiaris} MTSAGRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHG
DLEPAEGRGRTPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRK
SHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPV
LFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGGQDGRSPQARHDFDRPQASGGGSGGGGGGGGVGVLEQRPYRRESEI
*
7 >lcl|XP_003431602.1|Plus1complement(8961384..>8962091) NW_876252 ferritin, mitochondrial-like LOC481426 __SEG__ Chr11 {Canis lupus familiaris} IRAFLLSLRCARPGFALPPLRASGRPWRPRAPAPLRPLAAAAASRDPAPPACARARAGSRVRQNFHPDCEAAVNRQINLELYAAYAYLSMAYYFSREDVALNNFARYFLR
QAREEAQHAEKLMRLQNQRGGRICLRDVKKPDRDDWESGLRAMECALLLEKNVNQSLLELHTLASDQGDPHLCDFLETHYLNEQVKSIKELGDHVQNLVKMGAPDSGLAE
YLFDKHSLGNENNQN*
8 >lcl|XP_003431875.1|Plus19171303..9171830 NW_876257 ferritin light chain-like LOC100683543 __SEG__ Chr13 {Canis lupus familiaris} MSSQIRQNYSTEVEAAVNRLVNMHLRASYTYLSLGFYFDRDDVALEGGGHFFRELAEEKREGAERFLKMQNQRGGRALFQDVQKPSQDEWGKTLDAMEAALLLEKSLNQA
LLDLHALGSARADPHLCDFLENHFLDEEVKLIKKMGDHLTNLRRLATPQAGLGEYLFERLTLKHD*
9 >lcl|XP_003432465.1|Plus125089427..25089648 NW_876266 copper transport protein ATOX1-like LOC100683647 __SEG__ Chr18 {Canis lupus familiaris} MPKHEFSVDMTCEGCSNAVSRVLNKLGGVEFDTDLPNKKVSINSEHSVDILLGTLEKTGKAVSSAPSSEGLDP*
10 >lcl|XP_003432506.1|Plus1complement(12283024..12283233) NW_876267 copper transport protein ATOX1-like LOC100682888 __SEG__ Chr19 {Canis lupus familiaris} MPKHEFSVDMTCEGCSNTVSRVLHKLGGVEFDIDLPNKKVCINSEHSVDILLLETLEKTGKTVSYLSPK*
11 >lcl|XP_003433096.1|Plus1complement(52538012..>52538407) NW_876274 iron-sulfur cluster assembly 1 homolog, mitochondrial-like LOC100688120 __SEG__ Chr22 {Canis lupus familiaris} SEDVASLVQATVRAVSKGKLQPTGATLTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQDRVRVFIEKKAQLTLLGTEMDYVEDKLSS
EFIFNNPNIKGTCGCGESFNI*
12 >lcl|XP_003433174.1|Plus116335590..16336117 NW_876276 ferritin light chain-like LOC100688520 __SEG__ Chr23 {Canis lupus familiaris} MSSQIRQNYSTEVEAAVNRLVNMHLRASYTYLSLGFYFDRDDVALEGVGHFFRELAEEKREGAERFLKMQNQRGGRALFQDVQKPSQDEWGKTLDAMEAALLLEKSLNQA
LLDLHALGSARADPHLCDFLENHFLDEEVKLIKKMGDHLTNLRRLATPQAGLGEYLFERLTLKHD*
13 >lcl|XP_003433218.1|Plus149416754..49417440 NW_876276 methylosome subunit pICln-like LOC477122 __SEG__ Chr23 {Canis lupus familiaris} MSFLKSFPPPGSAWTEAVLKGKGLGTGTLCTAESRLSWLDGSGLGFSLEYPTISLHEVSRDLNAYPREHLHVMVNAKFGEESKESVAEEEEDSDDDVEPIAEFRFVPSDK
SALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQ
FEDADVDH*
14 >lcl|XP_003434798.1|Plus11665946..1666464 NW_876318 ferritin light chain-like LOC479746 __SEG__ Chr6 {Canis lupus familiaris} MSSRIRQNYSTEVEAVVNRLVNMHLRASYTYLSLGFYFDRDDVALEGVGHFFRELEKCEGAERFLKMQNQRGGCALFQDVQKPSQDEWGKTLDAMEAALLLEKNLNQALL
DLHALGSARADPHLCDFLENHFLDEVKLIKKMGDHLTNLRRLATPQAGLGEYLFERLTLKHD*
15 >lcl|XP_003434878.1|Plus1<23659178..23660479 NW_876321 potassium voltage-gated channel subfamily A member 3 KCNA3 __SEG__ Chr6 {Canis lupus familiaris} DPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDVFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRALQRQVWLLFEYPESSGPARGIAIVSVLVILVSIVI
FCLETLPEFRDDKDYAAAAQEQPEAARNGTSGPPAAAGFADPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAI
LRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTI
ALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSDYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV*
16 >lcl|XP_532397.1|Plus118890676..18891866 NW_876257 calcium-binding and spermatid-specific protein 1-like LOC475165 __SEG__ Chr13 {Canis lupus familiaris} MAEDGLPKIYSHPPTERGKTTTEATIFFGADNTIPKSEKNITSEGDHITPVNDYTLESDFSTTDSKLTSPKEKLKSEDNVGSRIIKSSTHVEKEIATLTGTVNSIANDSI
TENLIPVKIDNISSPGATVSLIDFSTNMAKEDILLDTTDPANEDVSITSEVSGTLKEGTTSIADTPNLPAKKDKPDDNNYSSSVKSNVTANEAVQITNSSIPEAEISTAT
EKNFTIPDITAFTEEKITEIDLSLPENDPNPVPKLTDSDEEKFITVFELTTTVERDKDNPEDILLTNEESMDEVNVWMEKDITNEAENNPILLTAVESRYDFVIPTSVAM
NLTEDSSTLTNEDLSENNAIEFVTKDSEPLSETTPDPDTLSHEEDAFTTEMGVFKLFKEEPDEFLI*
17 >lcl|XP_532686.2|Plus148068941..48069792 NW_876259 voltage-dependent anion-selective channel protein 3 isoform 1 VDAC3 __SEG__ Chr15 {Canis lupus familiaris} MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLRTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISLENKLAEGLKLTLDTIFVPNTGKK
SGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKFKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTHFG
IAAKYKLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA*
18 >lcl|XP_535567.2|Plus1complement(18027084..18027764) NW_876295 methylosome subunit pICln-like LOC478391 __SEG__ Chr31 {Canis lupus familiaris} MSFLKSIPPPLGSAAAAQDGGKGLGTSTLHIVQSRLSWLDGSGLGFSREYPTISLHAVSRDLNAYPRKHLYVMVNAKFGEESKESVAEEDSGDDVEPIAEFRFVPSDKSA
LEAMFTAMCECQALHPDPEDKDSDDYDGEEYDVEAHEQGQGDIPTFYTYEGGLSHLTAEGLATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFE
DADVDP*
19 >lcl|XP_538374.2|Plus19872906..9874252 NW_876251 inward rectifier potassium channel 4 KCNJ4 __SEG__ Chr10 {Canis lupus familiaris} MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEAGPAAAAAAAAAGAPTGSGAAA
PTAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEA
HVRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKS
HYKVDYSRFHKTYEVAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQATLPLDNI
SYRRESAI*
20 >lcl|XP_539100.3|Plus1623236..624669 NW_876255 potassium voltage-gated channel subfamily S member 2 KCNS2 __SEG__ Chr13 {Canis lupus familiaris} MTRRSPWDANEANVEDGEIRVNVGGFRRRLRSHTLLRFPETRLGRLLLCRSREAILELCDDYDDAQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGI
NEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYSDASKFDGQPLGNFRRQLWLALDNPGYSVLSRIFSVLSILVVLGSIITMCLNSLPDFQIPDSQGN
PGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVG
LLLLYLSVGISIFSVVAYTIEKEENEGLTTIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVP
SINLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSPH*
21 >lcl|XP_540081.1|Plus17724893..7726395 NW_876263 potassium voltage-gated channel subfamily F member 1 KCNF1 __SEG__ Chr17 {Canis lupus familiaris} MDAAGERSLPEPGSRGSRGSRGSRAGDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELMGCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGI
CPICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDSAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILISSVVMCMGTIPELQVLDADG
NRVEHPTLENVETACIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALKRSFKEL
GLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLETAAKHELELMELTS
SSGGEGKVGCSRSDLDSLPPEPVGEEGPSWSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK*
22 >lcl|XP_540095.1|Plus113309102..13310577 NW_876263 potassium voltage-gated channel subfamily S member 3 KCNS3 __SEG__ Chr17 {Canis lupus familiaris} MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINE
LFIDSCCSNRYQERKEENHERDWDQKSNDVSTDSSFEESSLFEKELEKFEQLRFGQLRKKIWIRMENPAHCLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDP
VLEGVEIACIAWFTGELAIRLVAAPCQKKFWKNPLNIIDFVSVIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLF
LSVGISIFSVLIYSVEKDEHTSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDIDVDQCNEDPPEKCQELPYFNI
RDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDVYNTASLENCTAK*
23 >lcl|XP_542519.1|Plus1complement(40146863..40148035) NW_876273 ATP-sensitive inward rectifier potassium channel 11 isoform 1 KCNJ11 __SEG__ Chr21 {Canis lupus familiaris} MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKNGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTAVPC
VTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIAVRHGRLCFMLRVGDLRKSMIISATIHMQVV
RKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDY
SKFGNTIKVPTPLCTARQLDEDRSLLDALTLASARGPLRKRSVAVAKAKPKFSISPDSLS*
24 >lcl|XP_542545.2|Plus1complement(50308573..50310573) NW_876273 potassium voltage-gated channel subfamily A member 4 KCNA4 __SEG__ Chr21 {Canis lupus familiaris} MEVAMVSAESSGCNSHMPYGYAAQARARERERLAQSRAAAAAAVAAATAAAAEGVGGPGGGAHQQHQQHQQHQQQQLQQQQPRGTCPALEPQGGRVARRRRRSRPNRRRP
QPRPGGFPHGSDLLPSGSEERILRELSDEDEDDEDDEDAEEEARLGRGQDDRAAHGSCSDLLPRDDGAYGPGRPSGCCERVVINVSGLRFETQMKTLAQFPDTLLGDPEK
RTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVI
LISIVIFCLETLPEFRDDRDLIMALGAGGHGGSLNDSSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQHQ
GGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGG
KIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETEKNNCSNAK
AVETDV*
25 >lcl|XP_543859.1|Plus1complement(39963751..39965238) NW_876284 potassium voltage-gated channel subfamily A member 1 KCNA1 __SEG__ Chr27 {Canis lupus familiaris} MTVMSGENVDEASAAPGHPQDGSYTRPAEHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPL
DMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDP
FFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI
FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSSPNLASDSD
LSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTANQNCVNKSKLLTDV*
26 >lcl|XP_544884.2|Plus132505304..32506434 NW_876295 ATP-sensitive inward rectifier potassium channel 15 isoform 1 KCNJ15 __SEG__ Chr31 {Canis lupus familiaris} MMDAIHISMSSAPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPSEDVSNHTPCIM
KVDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQT
HVTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQ
FEQIRKSPDCTFYCADSEKQKLEEKYRQEDQRERELRTLLLQQSNV*
27 >lcl|XP_545752.3|Plus122148668..22149807 NW_876305 ATP-sensitive inward rectifier potassium channel 10 KCNJ10 __SEG__ Chr38 {Canis lupus familiaris} MTSVAKVYYSQTTQTESRPLVGPGVRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVV
QVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAAHNGKPCLMIRVANMRKSLLIGCQVTGKLLQT
HQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLF
DQVVKVASPGGLRDSAVRYGDPEKLKLEESLREQAEKEGSALSVRISNV*
28 >lcl|XP_545973.2|Plus1complement(48131004..48131777) NW_876307 extracellular superoxide dismutase [Cu-Zn] SOD3 __SEG__ Chr3 {Canis lupus familiaris} MLAPALLCAHLLLAAPASRAWPGAAPDEPEPQPQPQPEPGPGAVAAQLSDMHDKVTAIWQQLTQRAAEPGAPGSALHAACRVQPSASLDPAQPRVSGLVLFRQPAPGAPL
EAFFHLDGFPAERNGSRRAIHVHRFGDLSPGCEAAGPHYNPRAAPHPHHPGDFGNFAVRDGRVRKHRGGLAASLAGPHSIVGRAVVVHAGEDDLGRGGDPASLDHGNAGR
RLACCVVGVCGPLPWARAAREHAERRKRRRDSDCQAA*
29 >lcl|XP_548949.3|Plus1complement(33124080..33124604) NW_879562 ferritin light chain-like LOC491829 __SEG__ ChrX {Canis lupus familiaris} MSTQINQNYSAKVEAALQYVVNLHLQASYTYRSLCFHFEGNNVALKGMGIFFQELAERKREGAQRLLKMRNQWSGDPLLSDGQLSEDPWRGSVDAMEAAMALEKNLNQAL
LDLHALGSANTDRRLCDFLEKHFVDEEMKLIKKMGDHLTNLRRLSGPQAGLSEYLFERLTLKHN*
30 >lcl|XP_853764.1|Plus17530690..7531949 NW_876331 inward rectifier potassium channel 16 KCNJ16 __SEG__ Chr9 {Canis lupus familiaris} MSYYGSSYPIVNVDPKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLNDPDITP
CVDNVHSFTGAFLFSLETQTTIGYGYRCVTEECSMAVLMVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQL
LRYTEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKRKYYKVNCLQFEG
SVEVYAPFCSAKQLDWKDQQLHNMEKAPPVRGSDTSDTTVRRRSFSAVAIVSSCENPEETPTSATDECKEAPYQKAVLTLNRISVESQM*
31 >lcl|XP_855115.1|Plus132148174..32148752 NW_879562 ferritin heavy chain-like LOC612281 __SEG__ ChrX {Canis lupus familiaris} MAAAPISQVRQNYHPDCEAAVDSRISLELSASYVYQSMAFSLERDDGALRNLARFFQRQAREETQHAEMLVELQNRRGGRIRLRDVKKPDRDAWESGPRATERALHLEKR
VNQSLPARPDLHRLATDQNDAQLCDFLEARSLRERASERARQGHPRALGGYGTSLRSVGAPEAGLAEYPFDRLTLRHSHKEN*
32 >lcl|XP_860635.1|Plus130825160..30825894 NW_876269 protein FAM133B-like isoform 2 LOC608277 __SEG__ Chr1 {Canis lupus familiaris} MGKRDNRVAYINPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWKKELEKHREKLLSGSESSSKKRQRKKKEKKKSGRYSSSSSS
SDSSSSSSDSDDEDKKQGKRKKKKKNRSHKSSESSMSETESDSKDSLKKKKKSKDANEKEKDIKGLSKKRKMYPEDKPLSSESLSESDYIEEVRAKKKKSSEEQEKEKTK
KKKKHKKHSKKKKKKAASSSPDSP*
33 >lcl|XP_866597.2|Plus123714019..23714744 NW_876254 chloride intracellular channel protein 1-like isoform 2 LOC474947 __SEG__ Chr12 {Canis lupus familiaris} MAEEPPQVELFVTAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLPYRTEVHTDTNNIEEVLEAVLCPPRYPKLAALNPESNTAGLDI
FAKFSAYIKNSNPALKDNLEKGLLKVLKVLDNYLTSPLPEEGDETSAENEGISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFSIPEVFRGVHRYLHNAYAREEFA
STCPDDEEIELAYEQVAKALT*
34 >lcl|XP_867783.2|Plus1complement(46834974..46835696) NW_876254 chloride intracellular channel protein 1-like isoform 2 LOC610493 __SEG__ Chr12 {Canis lupus familiaris} MAEEQPRVELFLKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQTLCPGGQLPFLRYRTEVHTDTKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
AKFSAYIKNPNPALNDNLEKGLPKALRVLDNYLTSPLPEEVDETRAEDEGISQRKFLDGNELTLADCNLLPKLHIVQVVCKKSRGFSIPEVFRGVHRYLRNACAREEFAS
TCPDDEEIELACEQVAKALK*