SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau P    

ID / Description / Sequence
1 >lcl|NP_001013624.1|Plus1complement(1334346..1335821) NW_001492974 potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3 KCNS3 __SEG__ Chr11 {Bos taurus} MVFGEFFHRPGPDEELVNLNVGGFKQTVDQSTLLRFPHTRLGKLLSCHSEEAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINE
LFLDSCCSNRYQERKEENHEKDWDQKSNDVSTDSSFEESSLFEKELEKFDKLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCIHSMSEFQNEDGEVDDP
VLEGVEIACIAWFTGELVIRLVTAPCQKKFWKNPLNIIDFVSIVPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLF
LSVGISIFSVLIYSVEKDDHTSSLTSIPVCWWWATISMTTVGYGDTHPVTLVGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDIDVDQCSEDPPEKCQELPYFNI
RDIYAQRMHAFITSLSSVGIMVSDPDSTDASSIEDNEDVYNTASLENCPPM*
2 >lcl|NP_001015552.1|Plus1complement(973847..975643) NW_001495105 potassium voltage-gated channel, shaker-related subfamily, member 5 KCNA5 __SEG__ Chr5 {Bos taurus} MEIALVPLENGGAMTVRGEEEARTTAGQLRCPTTAALSDGPKQPAPRRRSGGERGADPGGRPAPPPRQELPQASPRPPEEEDGEDDPALGVAGDQVLGPGSLHHQRVLIN
ISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIRFYQLGEEAMERFREDEGFIKEEEKPLPRNEFQRQ
VWLIFEYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPHQPPGPHRGPNGSGAAAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFA
CPSKAEFSRNIMNIIDVVAIFPYFITLGTELVEQQQPGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFA
EADNQETHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAAVKEEQGSQSQGTGSAGGGQRKASWSKGSLCK
VAGSLENADGSRRGSCSLEKCNLKAKSNVDLRRSLYALCLDTSRETDL*
3 >lcl|NP_001068633.1|Plus1complement(1034203..1035636) NW_001508726 P3 protein SLC10A3 __SEG__ ChrX {Bos taurus} MVFRSGEGHSLQWPGPEGGTGCTGPQSMLRATLLLVSLLWGARGTPSASLSPALGHPMPLTRGRYLSIGDGSVMEFEFPEESEGIIVITSQYPGQGNGTGPSPMLRVTSL
DPEVLAIKNVSSIALGSGGSFVVSIRSGLPGIAPLHIQLTDPREAPPRLIEERRDFCIKVSPAEDTPITLGTDLVHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLL
QNPQPMLLGLLGQFLVMPFYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFISTVAATGFLPLSSAIYSRLLSIHETLHVPVSKILGTLLFI
AIPIAAGVVIKSKLPKFSQLLLHVIKPFSFVLLLGGLFLAYRMGVFILAGVRLPIVLVGFTVPLVGLLVGYGLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRL
QADYASQAPFLVALSGTSEMLALVIGHFIYSSVCAVP*
4 >lcl|NP_001069762.1|Plus1complement(1880242..1881504) NW_001493708 potassium inwardly-rectifying channel J16 KCNJ16 __SEG__ Chr19 {Bos taurus} MSHYCSSYPIVSVDPKCPGYAPEHLLAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSYILSWLTFGSVFWLIAFHHGDLQNDGPDAT
PCVDNVHSFTGAFLFSLETQTTIGYGYRCVTEECPVAVLTVILQSILSCVINTFIIGAALAKMATARKRAQTIRFSYFALVGMRDGKLCLMWRIGDFRPNHVVEGTVRAQ
LLRYAEDGEGRMTMAFKDLRLLNDQIILVTPVTVVHEIDRDSPLYALDRKAVARDNFEILVTFIYTGDSTGTSHQSRSSYIPREILWGHRFHDVLEVKRKYYKVNCLQFE
GSVEVYAPFCSAKQLDWKDQQLHSVERAPPVRASAPPDAKVRRRSFSAVAIVSSSENPEETTPSAPEECKEAPYQKALLTLNRISVESQM*
5 >lcl|NP_001075067.1|Plus12104941..2106107 NW_001493305 potassium inwardly-rectifying channel J11 KCNJ11 __SEG__ Chr15 {Bos taurus} MLSRKGIIPEEYVLTRLAEDPAEPRYRARERKARFVSKNGNCNVAHKNIREQGRFLQDVFTTLVDLKWPYTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGAAVPC
VTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVV
RKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPCDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDY
SKFGNTIKVPTPLCTARQLEEDPSLLDVLTLVRGPLRKRTVAVAKAKPKFSISPDSLS*
6 >lcl|NP_001075070.1|Plus11466807..1467946 NW_001494714 potassium inwardly-rectifying channel, subfamily J, member 10 KCNJ10 __SEG__ Chr3 {Bos taurus} MTSVAKVYYNQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVV
QVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAAHNGKPCLMIRVANMRKSLLIGCQVTGKLLQT
HQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFIPAISLSASGKYIADFSLF
DQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSAVSVRISNV*
7 >lcl|NP_001076079.1|Plus11801621..1802346 NW_001495167 superoxide dismutase 3, extracellular SOD3 __SEG__ Chr6 {Bos taurus} MLALLCASVVLVAYASADQIQQQMGSNTEEQIRDMHAKVTEIWQEMMQRQAAAIDPDAALHAVCRVLPSATLEAEQPRVSGLVLFRQLRPGALLEAFFHLEGFPNEPNGT
NRAIHVHQFGDLSQGCDSTGPHYNPMSVPHPQHPGDFGNFAVRDGQVWKYRSGLAASLTGPHSIAGRAVVVHAGEDDMGRGGNQASLENGNAGRRLACCVVGLCGPGPWA
RQTQEHAERKKRRRESECKAV*
8 >lcl|NP_001091456.1|Plus1complement(1267935..1269422) NW_001492980 potassium voltage-gated channel, subfamily F, member 1 KCNF1 __SEG__ Chr11 {Bos taurus} MDGTGERSLPEPGSQDSRADDDIEIVVNVGGVRQVLYGDLLSRYPETRLAELIHCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFK
NEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDTAEGRWQRCQKCVWKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQVLDAEGNRVEHP
TLENVETACIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMY
LAVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLETAARHELELMELNSGTAGEG
KAGGSRGDLDHLPPPEPAGKEDPSWSSRLKLSHSDTFIPLLTEEKHHRTRLQSCK*
9 >lcl|NP_001092488.1|Plus11516531..1517658 NW_001493808 potassium inwardly-rectifying channel J15 KCNJ15 __SEG__ Chr1 {Bos taurus} MDPIHISMASAPLVKHTAGAGLKASRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPSEPPSNHTPCIMR
VDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTH
VTKEGEQILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKTGKYVADFSQF
EQIRKSPDCTFYCADSEKQKLEEKYRQEDQRERELRTLLLQQSNV*
10 >lcl|NP_001094665.1|Plus11206746..1208245 NW_001501822 potassium voltage-gated channel, shaker-related subfamily, member 2 KCNA2 __SEG__ Chr3 {Bos taurus} MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFS
EEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTD
PFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGL
LIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPS
SPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV*
11 >lcl|NP_776796.1|Plus1complement(779952..781937) NW_001493342 potassium voltage-gated channel subfamily A member 4 KCNA4 __SEG__ Chr15 {Bos taurus} MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGGGGSGGGAQHHHHPSRGACTSHDPQSGRGSRRRRRPHPEKKKVHHRQSSFPHCSDLM
PSGSEEKILRDLSEEDEEEDDEEDEEEEGRFYYSEEDHGEECSYTDLLAQDDGGGGGGGSGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQY
FDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISI
VIFCLETLPEFRDDRDLIMALSTGGHGGLLNDTSAPHPENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGN
GQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVG
SLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEKCQGKGDDSETDKNNCSNAKAVETD
V*
12 >lcl|NP_776798.1|Plus1complement(1843144..1844427) NW_001493708 inward rectifier potassium channel 2 KCNJ2 __SEG__ Chr19 {Bos taurus} MGSVRTNRYSIVSSEEDGMKLATLAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLH
GDLDASKESKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKS
HLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVL
FEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRPLRRESEI*
13 >lcl|XP_001249843.1|Plus1complement(874459..874938) NW_001494918 3-mercaptopyruvate sulfurtransferase-like LOC781347 __SEG__ Chr4 {Bos taurus} MVLQRLLPWSTCWTIFGSAEAALWGLKSIKRSCLSFCTAICEGVTYKELKNLLKSKKIMLIDVREPWEIYESGKIPGSVNIPLDDVGEALQMNPKDFKENYKEVKPSKSD
SLVFSCLAGVRSKVAMVTAISLGFNNAQHYAGGWKEWATYELSEKKQGN*
14 >lcl|XP_001250121.1|Plus11102523..1104253 NW_001501822 potassium voltage-gated channel, shaker-related subfamily, member 3 LOC782449 __SEG__ Chr3 {Bos taurus} MDEHLSLLRSPPQPSARQRAHPPQQPASGGGAHTLVNPGYTEPAAGSELPPDMTVVPGDHLLEPEAADGGGDPPQGGCGGGGGCDRYEPLPPALPAAGEQDCCGERVVIN
ISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQ
VWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKYYTASPSQEQFEASSNSTSGGPTGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMN
LIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAV
VTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQCLHVGSCQHLSPSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQAPFKT
GNSTATCTTNNNPNSCVNIKKIFTDV*
15 >lcl|XP_001250277.1|Plus11793..2320 NW_001506226 ferritin light chain-like LOC785297 __SEG__ Chr25 {Bos taurus} MSSQIRQNYSTEVEAAVNRLVNVQLRASYTYLSLGFYFDRDDVALEGVGHFFRELAKEKREGAERLLKLQNQCGGRALFLDVQKPSQDEWGKTQDAMEASLLVEKNLNQA
LLDLHGLASARGDSHICDFLENHFLDEEVKLIKKMGDHLTNLPRLAGPQAGLGEYLFERLTLKHD*
16 >lcl|XP_001250936.1|Plus1complement(1693011..1693556) NW_001493309 ferritin heavy chain-like LOC782705 __SEG__ Chr15 {Bos taurus} MTTASLSQVRQNYHQDSEAAINRQINLRLYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAERLMKLQNQRGGRIFLQDIKKPDRDDWENGLTAMECALCLERR
VNQSLLELYKLATEKNDPHLCDFIETHYLNEQVEAIKELGDHITNLSKMGAPGSGMAEYLFDKHTLGHSES*
17 >lcl|XP_001251064.1|Plus1111142..111669 NW_001493789 ferritin light chain-like LOC782921 __SEG__ Chr1 {Bos taurus} MSSQIRQNYSTEVEAAVNRLVNMQLRASYTYLSLGFYFDRDDVALEGVGHFFRELAKEKREGAERLLKLQNQRGGRALFLDVQKPSQDEWGKTQDAMEAALLVEKNLNQA
LLDLHGLASARGDPHICDFLENHFLDEEVKLIKKMGDHLTNLRRLAGPQAGLGEYLFERLTLKHD*
18 >lcl|XP_001251303.1|Plus1complement(2690039..2690566) NW_001494068 ferritin light chain-like LOC783220 __SEG__ Chr21 {Bos taurus} MSSQIRQNYSTEVEAAINRLVNMQLRASCTYLSLGFYFDGDDVALEGVGHFFRELAKEKREGAERLLKLQNQRGGCALFLDVQKPSQDEWGKTQDTMEAALLVKKNLNQA
LLDLHGLASARGDPHICDFLENHFLDEEVKLIKKMGDHLTNLRRLAGPQAGLGEYLFERLTLKHD*
19 >lcl|XP_001251438.1|Plus1complement(951173..951700) NW_001495246 ferritin light chain-like LOC784025 __SEG__ Chr6 {Bos taurus} MSSQIRQNYSTEVEAAVNRLVNMQLRASYTYLSLGFYFDRDDVALEGVGHFFRELAKEKREGAERLLKLQNQCGGRALFLDVQKPSQDEWGKTQDAMEASLLVEKNLNQA
LLDLHGLASARGDSHICDFLENHFLDEEVKLIKKMGDHLTNLPRLAGPQAGLGEYLFERLTLKHD*
20 >lcl|XP_001252363.1|Plus13383544..3384428 NW_001495055 voltage-dependent anion-selective channel protein 2-like LOC784294 __SEG__ Chr5 {Bos taurus} MATYGQNCTRPVCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIKDQICQGLKLTF
DTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLA
WTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGDTQTLRPGVKLTLSALVDGKNINAGGHKLGLALELEA*
21 >lcl|XP_001253132.1|Plus1666148..667464 NW_001493269 solute carrier family 10 (sodium/bile acid cotransporter family), member 5 SLC10A5 __SEG__ Chr14 {Bos taurus} MIRKLFIILLLSSVTLGEARKSFLSFLNIEKTEVLFITKTEETVVVRSSYRDKQPNSSYLRVQLEDDKMLQVVNVTKTLSDVTNFTIHLVTGGDGETNLTVQLWDSEGRR
ERLIEEIKNVRVRVLRQRQDSPFQASNLINRNILMLFLPMILLNKCAFGCKIEFQVFETVWKRPLPVVLGAVIQFFLMPFCGFLLTQILALPEAQAFGFIVTCTCPGGGG
GYLFALLLEGDVTLAILMTCTSTFLALVTMPTNSYIYSRILGLSGTLHIPISKIMSTLLFILAPMSVGIVIKHRLPDKAKFLERIIRPLSFILMFIGIYVTFSMGLVFLK
TVNLGVLLLGVLVPALGLLFGYFFAKISMLPLPVCKTVAIEGGVLNSFLALAIIQLSFSQSDADLASVAPFTVAMCSGCEMLLILLFYKAKKRCILNIEEKRMKNPPV*
22 >lcl|XP_001254820.1|Plus1complement(904908..905435) NW_001494181 ferritin light chain-like LOC788801 __SEG__ Chr23 {Bos taurus} MSSQIRQNYSTEVEAAVNRLVNMQLRASYTYLSLGFYFDRDDVALEGVGHFFRELAKEKREGAERLLKLQNQRGGRALFLDVQKPSQDEWGKTQDAMEAALLVEKNLNQA
LLDLHGLASARGDPHICDFLENHFLDEEVKLIKKMGDHLTNLRRLAGPQAGLGEYLFERLTLKHD*
23 >lcl|XP_001256112.1|Plus1complement(22322..22711) NW_001492908 ferritin light chain-like LOC789328 __SEG__ Chr11 {Bos taurus} MCGSLFSHLAKEKREGMESLLKMQNQRAGRVLFLDMQKPSQDEWGKTQDTMEAALLVEKNLDQALLDLHDLGSAHTDPHICDFLENHFLHEEVKLIKKMGDHLTNPHRLA
GLQAGLGEYLFKRLTLKHD*
24 >lcl|XP_001256369.1|Plus1complement(3073775..3074617) NW_001493688 hypothetical protein LOC789694 __SEG__ Chr19 {Bos taurus} MEEKPGQPQSQHHHSHHHPHHHPQQQQQPHHHHHYYFYNHSHNHHHHHHHQQPHQYLQHGAEGSPKAQPKLLKHEQKHALQQHQETPKKKRGYGELNGNAGEREMSLKSL
GSEEATNPISRVLNGNQHVVDTNLKQTVKSSTFGKAGIKTRNFIQKNSMDKKNGKSYENKSGENQSIDKTDTVAIPNGVLTNNSGYITNGYMGKGADNDGSRSESGYTTP
KKRKARRNSAKGCENLNLVQDKIMRQETNVPTLKQGLETFKPDYSDQKGNRVDGSKPIWK*
25 >lcl|XP_001787624.1|Plus1complement(1120896..>1121381) NW_001494989 solute carrier family 10, member 3-like LOC100138893 __SEG__ Chr5 {Bos taurus} HVPISKILGTLLFIAIPIAAGVVVKSKLPKFSQLLLHVIKPFSFVLLLGGLFLAYRMGVFILAGVRLPIVLVGFTVPLVSLLVGYGLATCLKLPVAQWRTVSIEVGVHNS
LLALAMLQLSLRCLQADYASQAPFLVALSGTSEMLALVIGHFIYSSVCAVP*
26 >lcl|XP_582110.1|Plus1complement(1098387..1099874) NW_001495105 potassium voltage-gated channel, shaker-related subfamily, member 2 KCNA1 __SEG__ Chr5 {Bos taurus} MTVMSGENADEASAAPGHPQDSSYPRPAEHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPL
DMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDEKDFPGAVHRLDNTTVVYNANIFTDP
FFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQKGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLI
FFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLHVSAPNLASDSD
LSRRSSSTLSKSEYMEIEEDMNNSIGHFRQANIRTGNCTTANQNCVNKSKLLTDV*
27 >lcl|XP_582224.2|Plus142263..43798 NW_001494746 potassium voltage-gated channel, shaker-related subfamily, member 10 KCNA10 __SEG__ Chr3 {Bos taurus} MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDPTTPKGWPGSSPFSNWKTLINDSTSHETVFSKLPGDYIDSPGPETVVLNEGYQRVIINIAGLRFETQLRTLNQFPET
LLGNREKRMQFFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARGVAV
VSVLVVIISITIFCLETLPEFREDRELKVVRDPSLNMSKTVLSHTMFTDPFFMVESTCIVWFTFELVLRFMVCPSKTDFFRNIMNIIDIISIIPYFATLITELVQETEPS
AQQNMSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTL
CAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQSIPGEINKLLNSAGSRMGSTDSLSKTNGSCSTEKSRK*
28 >lcl|XP_585917.2|Plus1complement(1580645..1581763) NW_001494527 potassium inwardly-rectifying channel J1 KCNJ1 __SEG__ Chr29 {Bos taurus} MFKHLRKWFVTRFFGRSRRRARLVSKDGRCNIEFGNVEAQSRLIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYVVAYVHKDLPEFHPPANHTPCVEHINGLT
SAFLFSLETQVTIGYGFRCVTEQCGTAIFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLRTTITPEG
ETIILDQININFVVDAGNENLFFISPLTIYHVIDHTSPFFHMAAETLPQQDFELVVFLDGTVEATSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVE
VETPHCAMCLYNEKDARAKMKRGYDNPNFVLSEVNETDDTKM*
29 >lcl|XP_586830.2|Plus1complement(898089..898802) NW_001492831 chloride channel, nucleotide-sensitive, 1A-like LOC539389 __SEG__ Chr10 {Bos taurus} MSFLRSFPPPGSAEGLRQQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEHPAISLHAVSRDLNAYPREHLYVMVNAKFGEESKESVANEEEEDSDDDIEPIS
EFRFVPRHKSALEAMFIAMCKCQALHPDPEDEDSDDYDGDEYDVEAHEQGQRDIPTFYTYEEGLSHLKAEGQATLERLEGMLSQSVSSQYNMAGVWTEDSIRDYEDGMEV
DTTPTVAGQFEGADVDH*
30 >lcl|XP_588194.4|Plus1<1121819..1122568 NW_001493185 potassium channel, subfamily K, member 9 KCNK9 __SEG__ Chr14 {Bos taurus} NNPXXXXXXXXXXXXXXXXXXCGLRNTEVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVI
GAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEARQGRPRYKADVADLQSVCSCTCYRPQEYGGRSAAHQNSFSAKLAPQYFHSISYKIEEISPSTLKNS
LFPSPISSISPGLHSFTDNHRLMRRRKSI*
31 >lcl|XP_588936.2|Plus1complement(1197647..1199233) NW_001495105 potassium voltage-gated channel, shaker-related subfamily, member 6 KCNA6 __SEG__ Chr5 {Bos taurus} MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGGCCSSERLVINISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRP
VNVPLDIFLEEIRFYQLGDEALAAFREDEGCLPEGGVDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRADGRGGSNGGGVSPGSRGS
QEEEEDEGDSYTFHPGIAPGGMVAGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIIDLVAIFPYFITLGTELVQQQEQQSATGGGGQN
GQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSL
CAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPAPDLKAADSGLGKPEFSEATRERRPSYLPTPHRGYAEKRMLTEV*
32 >lcl|XP_591595.3|Plus1complement(224346..224891) NW_001495133 ferritin heavy chain-like isoform 1 LOC513842 __SEG__ Chr6 {Bos taurus} MTTASPSQVRQNYHQDSEAAINLQINLELYASYVYLIMSYYFDRDDVVLKNFAKYFLYQSHEEREHAERLMKLQNQRGGRIFLQDIKKPDRDDWENGLTAMECVLCLERS
VNQSLLELHKLATEKHDPHLCDFIETHYLNEQVEAIKELGDHITNLRKMGAPGSGMAEYLFDKHTLGHSES*
33 >lcl|XP_591688.2|Plus11274541..1275086 NW_001508821 ferritin heavy chain-like LOC513925 __SEG__ ChrX {Bos taurus} MPAPLQECQNYHPDCEAGVNGQVNLQIYASYVYLSMAFYFDRDDVALKRFSHFFLRCSHKHKEQIESLMHLQNRHGGRFCLQDLRKPDRTNWESGLLAMQCALHLEKSVN
QSLLDLYQLATDKNDPHLYHFLKTHHLDQQVEFIKKLRDHVSNLPKMGAPEVSMAEYLFDKLTLGDGDKED*
34 >lcl|XP_592772.3|Plus1complement(2280163..2281596) NW_001493251 potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2 KCNS2 __SEG__ Chr14 {Bos taurus} MTGQSLWDVSEANVEDGEIRINVGGFKKRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDAQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGI
NEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDRQGN
PGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVG
LLLLYLSVGISIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVP
SVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLH*
35 >lcl|XP_603860.2|Plus11124241..1125971 NW_001501822 potassium voltage-gated channel, shaker-related subfamily, member 3 LOC525507 __SEG__ Chr3 {Bos taurus} MDEHLSLLRSPPQPSARQRAHPPQQPASGGGAHTLVNPGYTEPAAGSELPPDMTVVPGDHLLEPEAADGGGDPPQGGCGGGGGCDRYEPLPPALPAAGEQDCCGERVVIN
ISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQ
VWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKYYTASPSQEQFEASSNSTSGGPTGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMN
LIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAV
VTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQCLHVGSCQHLSPSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQAPFKT
GNSTATCTTNNNPNSCVNIKKIFTDV*
36 >lcl|XP_610462.1|Plus1464603..465139 NW_001508818 ferritin light chain-like isoform 1 LOC531957 __SEG__ ChrX {Bos taurus} MSTQIQQSSPEMEAAASRLIKLHLEVSSTYVSLSVYFEGSGMAMNGVGHFFRMLAKEKQEGAQLLLKMRKSWGDGALVQSGQTLSPEKWNASVEAMEYAVALEKSLNQAL
LDLHALGRASADVQLCEFLERRFLEDEMMLLKKMGDHLANLRKITSPQAGLQAGLAEYLFEKLSFQCD*