SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr O    

ID / Description / Sequence
1 >lcl|NP_001038029.1|Plus154367..55113 NW_003534998 14-3-3 protein sigma SFN __SEG__ Chr6 {Sus scrofa} MERASVIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVEKELRGVCDTVLGLLNTHLIKE
AGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIM
QLLRDNLTLWTADNAGEEGGEAPEEPQS*
2 >lcl|NP_001106147.1|Plus1379742..380026 NW_003536210 small ubiquitin-related modifier 4 precursor SUMO4 __SEG__ Chr14 {Sus scrofa} WPMKSPRKESRLRTTIY*FEGGGQDGSVAQFKIRRHTPLSKLVKACCERQGLSIRQIRFRVDGQPINETDTPAQLELEDEDTIDVLQQQTGGVY*
3 >lcl|NP_001121957.1|Plus1complement(261915..262964) NW_003300233 FK506-binding protein-like FKBPL __SEG__ Chr7 {Sus scrofa} METPPVSPLGEKNISQPQQRWKKNSQKILDSTTQIRQQPQDPSTELLEGRVSPDPAGQILENLQEIEKLAVGREGDSDKSHGPASEMPEPLQASELWYCPDGSFVKKILI
HGHGLDKPKLGSRCRVQVLGFPLGSGLPEGWTELTMGLGPWREETWGELVEKCLESMCQGEEAELQLPGRSGPPVRLKLASFTQGRDSWELEPTEKEALAREERARGTEL
FRAGNPEGAARCYGRALRLLLTLPPPGSPERTVLHANLAACQLLLGQPHLAAQSCDRVLEREPGHLKALYRRGVAQAALGNLDKATADLKKVLAVDPKNRAAQEELGKVI
IQGKKQDAGLAQGLRKMFG*
4 >lcl|NP_001177112.1|Plus1complement(505022..506149) NW_003534696 protein arginine N-methyltransferase 6 PRMT6 __SEG__ Chr4 {Sus scrofa} MSQPKKRKLESGGGGEGGEGTEEEDGGEQEAALPRPRRTRRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
VEASDIWQQAREVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPICDQMLELRLSFWSQMKQLYGVDMS
CLESFATRCLMGHSEIVVQGLSGEDVLARPQCFAQLDLARAGLEQELEAGVGGRFRFSSYGSAHMHGFAIWFQVTFPSGDWRNPLVLSTSPFHPVTHWKQALSXPERARA
SGARYGRFRRDYAPALPGQPPSPARAAALQSGRPGGKDQRLCHGGL
5 >lcl|NP_001191324.1|Plus1<993180..994706 NW_003536280 interferon-induced protein with tetratricopeptide repeats 3 IFIT3 __SEG__ Chr14 {Sus scrofa} SEVNKNSLEKILPQLKCHFTWNLPKEEHVWHDLEDRVCNQTELLNSEFKATMYNLLAYIKHLNGQNEAALEYLQQAEEFIQQEHTDQAEIRSLVTWGNYAWVYYHLGRLS
EAQIYVDKVKQVCEKFSNPYSIECPELDCEEGWTLLKCGGKQIEKAKVYFEKALEEKPDNPEFSSGLAIAMYFLNGKPAQQSSVDILKEAIELSPDNQYIKVLLALTLQK
MNEEAEGEELVVEALEKAPRQTDVLRSAAKFYRVKGDLDKAIELFLTALESTPNNGYLYHQIACCYRAKVKQLLDAGESEASRNREIIEELRKYAKDYVNKAIEKGLNPL
YAYSDSTELLEIGECHQTAFSKELPSTEAQQLHQRSCNSQEYHEKSEDTAAQQSLENLSINTKSTEKEKMKYQLQNGAANQLPQSAPNSWYLRGLIHKMNGDLLQAAACY
EKELGYLLRNSPSGIGSIFQPASELEEGTEEMDQGADGSTLRELPDPGADRDRKERKGTESQGAWNSG*
6 >lcl|XP_001925048.1|Plus1complement(303527..305023) NW_003299282 probable E3 ubiquitin-protein ligase makorin-3-like LOC100155343 __SEG__ Chr1 {Sus scrofa} MEEPAAPTEPYEAAGTFGDIEAAGEIKPWPTLPVPPTSRWSPAPGPAPFRPSRVRPAQESGGGAGPRWLPGRSSGSWTKEVVCRYYLHAQCKEGENCRYSHDLSGRQVAR
EGPGSPPPASTDSGPSAAAHAEALPQEVAEAPPAVSSRSFPLIGSAERVFFEAETEYAGLEAAGGAGAEGWEHAIEFVPGQPYQGRMAPPIYVAPPQGLLTVREQFALGQ
RQQLCRDAIMGQCFRGPSCMYLHGDMCDLCGLKVLHPFDGAQRADHRRACMEAHEQNMELSFAVQRSADKVCGICMEVVYEKANRNDCRFGILSSCNHTYCLKCIRRWRS
ARQFGTWVVKSCPQCRVISTFVIPSEFWVEEEEEKQRLIQQYLEAMSHKPCRYFVRGRFCPFEENCFYKHAFPEGQGEEPQRQGAGAPGPWRGQLLEPPQVGEGDMPFKS
CKKELVMLWLANLLCQCFLSWGANELPCSETQWDLLHCELEEYFNLNLWHSVACCMVC*
7 >lcl|XP_001925081.2|Plus1563873..564778 NW_001885767 ret finger protein-like 4B-like LOC100156609 __SEG__ Chr1 {Sus scrofa} MANNLQDEAACTVCLEVFFSPITLSCTHTFCLYCMQSWMKEQEDLKLVCPMCRGVIENPPLKDWQIEELALLITQHSSRLEQGMHMSDEYLKFWEDITLDPATANSFLVF
SEDLRSIQYGKIYQNLMEDPQRFDYWAGVLGTPCFVSGCHYWEVEVGEGNEWALGVCKMSVNRKRPSGFSSDHGFWIIRMKAGTIYTFSVLETRIPVSPGLCHVGVFLDI
ELEEIKFFDVSNDVLIYTHNNLSCLEPLCPFFSLELPREGEKGASLKICPSEMNPFIETSCEMNEVFDVRNEIHPFLETAC*
8 >lcl|XP_001925396.1|Plus1675073..675990 NW_003534634 peroxisome biogenesis factor 2-like LOC100152963 __SEG__ Chr4 {Sus scrofa} MASRDENSKQANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFLWLFLWRFTIYSKNATVGQSVLNIQYKNDFSPDLRYQPPSKTQKLWYAICT
IGGKWLEERCYDVFRNRHFASFKKAKQCVHLVVGLLKLGGLINFLIFLQRGKFATLTERLLGIHSVFCKPQNVRDVGFEYMNRELLWHGFAEFLIFLLPLVNIQKMKAKL
SAWCTPVTGAPSGDGALGTSGKLCALCGEWPTMPHTMGCQHVFCYYCLKSSFLFDMSFACPKCGTKVHSLQPLKSGLEMSEVNTL*
9 >lcl|XP_001925551.1|Plus1complement(637464..638204) NW_003534661 proteasome activator complex subunit 3-like LOC100154887 __SEG__ Chr4 {Sus scrofa} MASSLKLEQDVQGKVDSFRARIAQEAEDLVSTFFPQKLSELDSQVQELRLQDLSRIRSVPAPETTVSPDTVGDGPNRSPQPLQTQPSIRVPALPGGEGQLLRSNQHLVEL
IERVKPEIELLREKCNTVRMWVQLLIPKVEDGNNFGVSIQEDTVDQLWTVESTAASYLRRFSTYYNTRAKLVSKIVKYPQVEDYRRTVAEVDENEYLSVRQILLHVRNQY
ATLHDVILKNIEKIKTPRSTNTDNLY*
10 >lcl|XP_001925596.3|Plus1complement(801442..802653) NW_003536025 tripartite motif-containing protein 59 isoform 1 TRIM59 __SEG__ Chr13 {Sus scrofa} MHNFEDELTCPICYSIFEDPRVLPCSHTFCRNCLEDILQASGNFYIWRPLRIPLKCPNCRSIIEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCL
LDKKLVCGHCLTIGQHHGHPIDDLQSAYIKEKDTPQKLLDQLTDTHWTDLTHLIEKLEEQRSHLEKMVQGDKEVVLQYFKELSDTLEQKKKNFLTALCDVDNLINQECTP
QIERMKEMREQQLELMTMTASLQEESPLKFLEKVDDIRQRVQLLKQRPLPEVQPVEIYPRVSQVFKEDWSRTEIGQIKELLIPEMKISSKRMPCSWPDKDVKEVEFFKIL
NLVIVTLISVILMLTLFFNQHVITFLNEVTSTCFAEVSLSVYQSLSNNLHDLKNILCHTLYLLKEFMSKIISH*
11 >lcl|XP_001925597.1|Plus1complement(672253..674418) NW_003536181 disintegrin and metalloproteinase domain-containing protein 25-like LOC100153750 __SEG__ Chr14 {Sus scrofa} MANYDGSIIAVGDFLVYMKIPLLLLWPKVFLFLPGWSQIGHSQRHGPQEVVIPLKVTNTGRDVKSHGWLSYRLYFGGKIYVIHIKVKKHFLSKNLPVFTYTDQGALLEDH
PFIQNDCYYHGYVEGDPESLVSLNTCLGGFQGMLQTNDIVYKVEPKRLSTTFEHLVYKMDNEETEFPPMSCGLTDEEIEQQVTFQESVNSTLMQSGYEGWWTHRRFLEVA
VVVDHTRYLHHQRNTSLVQNEVCFIFHGISDLLKSLDIDVFLMGIEVWTEESYVSLHSIGDGLNGFCKWKRRGFNTRLPHDVAHIFVKKDFGTNVGLAFVGTVCKTHTNC
GIDSFLNGDITDSAYIVSHEIGHNLGMGHDDTKTCGCGRSKCIMFPYKATTTKFSNCSYMNYWNRIAQKPCVYTSPDPQKVFMIKGCGNRVVDEGEQCDCGSRYMCEKDP
CCQSDCTLTAGADCAFGLCCEECSFMPAGSMCRKEENECDLPEWCNGTSHQCPEDVYMQDGTSCTGGGYCYEKRCNNHNEQCRKIFGKQARSADQSCYREMNTRGDRFGN
CGLKATKYVRCNISDILCGRLQCENVTEIPLLRDHSTVHWTHFNGVTCWGTDHHLGMTLPDVGEVKDGTECGAGHVCIQRKCVHMSLWESACSPETCNMSGVCNNRHHCH
CNSEWAPPKCLLKGSGGSVDSGPPPGKNEKVERKNNLLPLWLILLFVLLVSLLLLIFMRRT*
12 >lcl|XP_001925798.1|Plus1complement(1795072..1795947) NW_003535232 proteasome subunit beta type-11-like LOC100153926 __SEG__ Chr7 {Sus scrofa} MALQDVCQWQALDPQGASPYLPQAGAWAVPRGWDPQTFLQTHGPRLAHGTTTLAFRFRDGVIAAADTRSSCGNYVECPASRKVIPVHQHLLGTTSGTSADCTTWYRVLRR
ELRLRELREGQLPSVAGAAKLLSGMMSRYRGLDLCVATALCGWDRSGPALFYVYSDGTLLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALACRAVAHATHRDAYSG
GSVDLFHVRESGWEHVSRNDAWVLYSELQKLSGLEKEGEEEATSERAGPGREPSVGPAPGDLRMPSEMEKL*
13 >lcl|XP_001926395.3|Plus1246116..246631 NW_003301804 cellular nucleic acid-binding protein-like LOC100154211 __SEG__ ChrX {Sus scrofa} MSNKECFKCGRSGHWARGCPKGGGARGRGSRGRGRGPHCSSTTLPIICYRCGEPGHHAKNCDLQEDICYNCGKSGHIAKDCMEPKRERDQCCYTCGRPGHLARDCDRQEE
QKCYSCGERGHIQKDCTQVRCYRCGETGHVAINCSKPSEVNCYRCGESGHLARECPIETTT*
14 >lcl|XP_001926597.1|Plus167049..69232 NW_001886254 disintegrin and metalloproteinase domain-containing protein 30 ADAM30 __SEG__ Chr4 {Sus scrofa} MRSVRTFLSQGPLLPTLVLVVLLVDSLGKDLNLPPGWDFDSYEITIPKKLSFRGGVQGVAKHVSYLLQVKGKSHVLHLWPKRFLLPRNLQVFSFTELGRLWEDHPYIPSN
CNYMGLVEGNQDSEATLSTCMGVLRGILKIDASHYQIEPLKASSSFEHVIYLLKKEEEFPHQICGLTDDETLKQMAQHKNVARISDFSQSYMHQKYLELALVFDHSRYIF
LNSNLSRVINDAILLSSIMDTYFQDVRMRIHLTGVEVWTDEDKIRLTYPKLEQVLGQFMVYRTSVLNARFPVDWIHLYLKRNYSDSLALYLGNVCTKFHAGSTSVFPDVN
VLGPATWSTHALGHGVGMRHDEEYCQCKGRHSCIMGSGQYGFSNCSYAHFFAHVYSGAKCLTNIPELSYVVKRCGNKIVEEDEECDCGSIEDCKNDHCCQPDCKFKHGAK
CSIGLCCHKCQFRPSGYKCRLEENECDLAEYCNGTSALCPSDTYKQDGTPCKDEAHCFNKACQSRFMQCQKIFGPDATEAPLQCYVAINVIGDQYGNCGISGVREYRKCN
RRNALCGRIQCINVNTIPDMPDHTILISTHLHDENLKCWGIGYHPAMVPMGLPDLGVVSDGTSCGRNNVCFNRNCVNSSVLKFDCFPEKCNHRGVCNNNKNCHCMYGWSP
PLCEELGYGGSIDSGPPGPLKEGVPTSVQVVSLMFVRLIFLIISVIVVFFKKIIGNFKTQRESNPTT*
15 >lcl|XP_001927471.1|Plus1752930..753799 NW_003536796 OTU domain-containing protein 6A-like LOC100153003 __SEG__ ChrX {Sus scrofa} MEDSQSEHQRMIRRHNREKKELQARIQSMKNSVPRSDKKRRKQMLLDVARLEAEMEQKHQQELEKFQESFPGNLDSVTEDLAKMDLENQPPRPSRAQRRRERRAALARER
QERIAEAEMEHLASFRKDEEEKLRAILGAKNLEMKDIPADGHCMYRAIQDQLVFSVTVESLRRRTAEYMQKHVDDFLPFFSDPETGDSYSRDDFLSYCDDIVRSASWGGQ
LELRALSHILQTPIEVIQANSPAVVIGEEYTKRPLILVYMRYACSLGEHYNSVKPLEAGAVGGAPPRLF*
16 >lcl|XP_001927636.2|Plus1complement(752851..755061) NW_003536181 disintegrin and metalloproteinase domain-containing protein 29 ADAM29 __SEG__ Chr14 {Sus scrofa} MVASKMTVIKALFYMRIIPLLHWLGVFPPFSGHIWAVQPHYQSPPEVVIPLRVNGTGRSMQPPGWLSYSLHLGGQRHVFHMQVKKHLLPRHLPVFTYTDQGALLEDKPFV
QNDCYYHGYVEGDPESLVALSTCFGGFRGLLQINYVVYEIKPMIFSTEFEHLLYKVDSEETQFPTMKSGFMQEEIVHQFEFQETGNFTLKQSHVKGWWIHSIIVEVGAVV
DNTLYNHFKQNISRLQEDLFLIVNIVDSIYQELGVKVLLFGMEIWNRRNHVEVGPERRTLTDFCIWKAGNIDARMAHDTIHLFINKTIRGLTGLGYVKGMCKSKYSCAVV
TFADRTVPIIGIAMAHHLGHNLGMYHDYGYCMCSVGYYRCIMNYDNPQIVQFSNCSFSQFWDYSVHEAQCLRYAVYQKDIFSRKRCGNGIVEEGEQCDCGSLQNCSKDAC
CLTNCTLSLGSACAFGLCCKDCQFLPSGEMCRKEINACDLPEWCNGTSHMCPDDVYVEDGIPCNNSAYCYEKRCNDRNTQCRQIFGQEAKNAQNICYKQVNTQGDRFGNC
GVEGSSYLKCNMSNILCGRIQCDNVTEIPLLREHSTVHGTRFKDVTCWGTDYHIGMTIPDIGEVKDGTECGQEHVCIQRKCVHLSRLDSNCSPTFCNMRGICNNKHHCHC
NYKWDPPNCLIRGDGGSVDSGPPPRRTRIKKIYLLIPCLILLLLLLCCLLLLCMRKKPKGQKQKSQPQPEKSKAKN*
17 >lcl|XP_001928351.1|Plus1complement(518888..521239) NW_003535274 interferon regulatory factor 2-binding protein-like LOC100152768 __SEG__ Chr7 {Sus scrofa} MSAAQVSSSRRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRAHGCFQDGRSPGPPPPVGVKTVALSAKEAAAAAAAAAAAAQQQQQQQQQQQ
QQQQQLNHVDGSSKPAVLAAPSGLERYGLSAAAAAAAAAAAVEQRSRFEYPPPPVSLGSSSHAARLPNGLGGPNGFPKPTPEEGPPELNRQSPNSSSAAASVASRRGTHG
GLVTGLPNPGGGGGPQLTVPPNLLPQTLLNGPASAAVLPPPPPHGLGSRGPPTPAPPGAPGGPACLGGTPGVSAASSSASSSTSSSVAEVGVGAGGKRPGSVSSTDQERE
LKEKQRNAEALAELSESLRNRAEEWANKPKMVRDTLLTLAGCTPYEVRFKKDHSLLGRVFAFDAVSKPGMDYELKLFIEYPTGSGNVYSSASGVAKQMYQDCMKDFGRGL
SSGFKYLEYEKKHGSGDWRLLGDLLPEAVRFFKEGVPGADMLPQPYLDASCPMLPTALVSLSRAPSAPPGTGALPPAAPSGRGAAASLRKRKASPEPPDSAEGALKLGEE
QQRQQWMANQSEALKLTMSAGGFATPGHAAGGPPPPPPPLGPHSNRTTPPESAPQNGPSPMAALMSVADTLGTAHSPKDGSSVHSTTASARRNSSSPVSPASVPGQRRLA
SRNGDLNLQVAPPPPSTHPGMDQVHPQNIPDSPMANSGPLCCTICHERLEDTHFVQCPSVPSHKFCFPCSRESIKAQGATGEVYCPSGEKCPLVGSNVPWAFMQGEIATI
LAGDVKVKKERDP*
18 >lcl|XP_001928419.1|Plus1complement(775718..776176) NW_001885237 ubiquitin-conjugating enzyme E2 B-like isoform 1 LOC100156381 __SEG__ Chr13 {Sus scrofa} MSTPARRRLMRDFKRLQEDPPVGVSDAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQ
SLLDEPNPNSPANSQAAQLYHENKREYEKRVLAIVEQSWNDS*
19 >lcl|XP_001928631.1|Plus11079427..1079885 NW_003533913 ubiquitin-conjugating enzyme E2 N-like LOC100154647 __SEG__ Chr1 {Sus scrofa} MARLPFRIKKETQWLLKEPIPGIKAEPDETNAHYFHVVIDGPQDSPFEGGTFKLELFVPEEYPIKPPKARFVTKIYHPNIDKLGRICLDILKENWSPALQIRTVLLSIQA
LLGDPNPDDPLAYDVAKQWKTNKAQAIETARAWTRLYAMNNV*
20 >lcl|XP_001928710.1|Plus1243304..244047 NW_003535147 e3 ubiquitin-protein ligase RNF182-like LOC100154575 __SEG__ Chr7 {Sus scrofa} MASQPPEDAAESQVSDELECKICYNRYNLKQRKPKVLGCCHRVCAKCLCKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVTLTCGGKGRKCLPENPTELLL
TPKRLASLVSPSHASSNCLVITIMEVQRESSPSLSSTPVVEFYRPSSFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVP
SSLVILMVYGFCQCVCHEFLDCLAPSS*
21 >lcl|XP_001929318.1|Plus12700613..2700891 NW_003534665 dolichol-phosphate mannosyltransferase subunit 3-like isoform 1 LOC100153065 __SEG__ Chr4 {Sus scrofa} MTKLAQWLWGLALLGSTWAALTMGALGLELPSSCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGMRF*
22 >lcl|XP_003121754.1|Plus1complement(79203..79814) NW_003299301 e3 ubiquitin-protein ligase RNF152 PIGN __SEG__ Chr1 {Sus scrofa} METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKLPPGFSVSQLPDDPEVLAVIAIPHASEHTPVFIKLPSNGCYMLPLPISKER
ALLPGDMGCRLLPGSQQKSVTVVTIPAEQQPLQGGVPAEAAEEEQDRRGAVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG*
23 >lcl|XP_003122395.1|Plus187493..88290 NW_003299439 RING finger protein 208-like LOC100515466 __SEG__ Chr1 {Sus scrofa} MPADPGPEAGSGWPGFLMSCLKGPHVILKMEAMKIVHPEKFPELPAAAPCFPPAPRPTPALAPKRAWPSDTEIIANQACGGDMPALEGAPRTPPLPRRPRKGSAELGFPR
VAPADEVIANQYVIRPGSAASGGPAASAPAAGEPLECPTCGHTYNVTQRRPRVLSCLHSVCEQCLQILYESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSILSRLPP
EALTAPSGGQWGGEPEGSCYQTFRQYCGAACTCHVRNPLSACSIM*
24 >lcl|XP_003122752.1|Plus1207769..208089 NW_003299464 glutaredoxin-1-like LOC100518292 __SEG__ Chr2 {Sus scrofa} MAQAFVNSRIQPGKVAVFIKPTCPYCRRTQKLLSQLPFKEGLLEFVDITATSDTNKIQVYLHHLMGARTAPRVFMDEECIGGCTDFVSMHERGELLTHLKQIGALK*
25 >lcl|XP_003123129.1|Plus1complement(66453..67535) NW_003534269 zinc/RING finger protein 4-like LOC100511549 __SEG__ Chr2 {Sus scrofa} MGRQRWPALALGAVRASLILLGLLVPAQAVVRAVLDGNSSTVDFADLPALFGVPLAPEGVRGYLIEAKPANACHPIEGPQLGNGSLGAIVLIRRYDCTFDLKVLHAQRAG
FEAAIVHNVHSDDLVRMGHVYEDLRRQIAIPSVFMGEAASQDLRAIVRCDKSAHVLLLPDYPPCPDLDCHPVLAVSWVLGRTLALLTSAVFVLRHLWNWLWAWWTREPPV
KAPAGQRAQVRTFTRRNDLCAICLDEYEEGDRLKILPCSHTYHCKCIDPWFSQAARHSCPVCKQSVAGTEDGSDSTINSYGDEEDSSLPGRHPPIWAIQARLRSRRLELL
ARAGPSRSRSATSVGAAEAHASEAGPAQPH*
26 >lcl|XP_003124110.1|Plus1complement(159340..159801) NW_003299624 putative E3 ubiquitin-protein ligase SH3RF2-like LOC100524364 __SEG__ Chr2 {Sus scrofa} MDDATLLDLLECPVCLEKLDVTAKVLPCQHTFCRPCLQRIFKAHKELRCPECRTLAFCSIEALPANLLLVRLLDGVRSGQGSGTRGSFRRPGVLTSQDGKKSRTHPRGLP
CSPFRLVPNVRIHMDGVRAISFVLSCPLGGWVCALQQFGVLFF*
27 >lcl|XP_003124457.1|Plus1complement(561342..562022) NW_003534412 dnaJ homolog subfamily C member 30-like LOC100525511 __SEG__ Chr3 {Sus scrofa} MAAQRDLRRSRLLLWRLWQARGVPQNPGLGLSLKTRTYSQSDGPYSRTALYELLGVPSTATQAQIKAAYYRQSFLYHPDRNSGSAEAAERFTRISQAYVVLSSATLRRKY
DRGLLSDEDLRGPGVRPSKKPTADPDSPRTPPPASRAHGRGQASAGASNTMFNFDAFYRAHYGEQLERERRLRARREALRKQQEDRANKGLRWDEIRDSAFFLFLLTVFI
IMSFRF*
28 >lcl|XP_003125153.1|Plus1291683..292051 NW_003534497 prefoldin subunit 1-like LOC100522989 __SEG__ Chr3 {Sus scrofa} MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHNQLLEKQKIAEEKIKELEQKKSYLERSVKEAED
NIREMLMPRRAQ*
29 >lcl|XP_003125309.2|Plus17284..7664 NW_003534528 small ubiquitin-related modifier 1-like LOC100514709 __SEG__ Chr3 {Sus scrofa} IIQGKPWSKVLPIQGHCWAQTPGEAAVTMEAKPSTEELGDEKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMISLRFLFEGQRIADNHPPKELGMEEE
DGIEIYQEQTGCHSVV*
30 >lcl|XP_003125467.1|Plus1110656..111033 NW_003534567 butyrophilin subfamily 1 member A1-like LOC100518658 __SEG__ Chr3 {Sus scrofa} MQSWDLGICRDNVTREGVFTMSPQNGFWAIRLYDGDYWALTSPETSLPLRERPLKVGIFLDYEAGDVSFYNMTDGSHIFTFPQNTFYGVLRPLFRLWSSDSGSLTICSAE
GECTDIIHKSTLQAK*
31 >lcl|XP_003125750.1|Plus1complement(2131911..2132231) NW_003534665 glutaredoxin-1-like LOC100519480 __SEG__ Chr4 {Sus scrofa} MAQAFVNGKIQPGKVEVSLKPTCPYCRRTQELLSLLPFKQGHLEFVHIIATGDSNKIQDYLQQLMGARMVPLVFISKECVGGCTNLVSMHKRGEHLTCLKQTGALQ*
32 >lcl|XP_003127276.1|Plus1complement(67222..68976) NW_003534958 interferon regulatory factor 2-binding protein 1-like LOC100512233 __SEG__ Chr6 {Sus scrofa} MASVQASRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHVLPEGRSPGPPALKHPATKDLAAAAAQGPQLPPPQAQAQSSGAGGAVSGQD
RYDRATSSGRLPLPSPALEYTLGSRLANGLGREEAVAEGARRALLGSMPGLVPPGLLAAAVSGLGSRGLTLAPGLSPARPPFGSDFEKEKQQRNADCLAELNEAMRGRAE
EWHGRPKAVREQLLALSACAPFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTEYPCGSGNVYAGVLAVARQMFHDALREPGKALASSGFKYLEYERRHGSGEWRQL
GELLTDGVRSFREPAPAEALPQQYPEPAPAALCGPPPRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPYSNDTPGVPSPIAALKNVAEALGHSPKDP
AGGGGPVRAGGASPAASSTAQPPAQHRLVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGD
KCPLVGSSVPWAFMQGEIATILAGDIKVKKERDP*
33 >lcl|XP_003127997.1|Plus1complement(340051..340398) NW_003535089 mitochondrial import inner membrane translocase subunit TIM14-like LOC100521801 __SEG__ Chr6 {Sus scrofa} MASTVVAAGLTIAATGFAGRYTFQAMKHMEPQVKQIFQSLPKSAFHGGYYRVGFEPKMVTWEAALILGISPTANKGKIRDAHQKITLLNHPEGGSPYTVAKINEAKDLLE
GQGKK*
34 >lcl|XP_003127998.1|Plus1complement(486672..487019) NW_003535089 mitochondrial import inner membrane translocase subunit TIM14-like LOC100521976 __SEG__ Chr6 {Sus scrofa} MASTVVAAGLTIAATGFAGRYTFQAMKHMEPQVKQIFQSLPKSAFHGGYYRVGFEPKMVTWEAALILGISPTANKGKIRDAHQKITLLNHPEGGSPYTVAKINEAKDLLE
GQGKK*
35 >lcl|XP_003128202.1|Plus1complement(180330..181391) NW_003300217 putative protein phosphatase 1 regulatory inhibitor subunit 3G-like LOC100522260 __SEG__ Chr7 {Sus scrofa} MEPRGMELLSLEALGPVPFEDTPPAGEPPAPGVLSTDGGGDGGGTSKVPNPDAEPPFLQEEAALREQEELLESRRRRRARSFSLPADPILQAAKFLQQQPPPAPGTGSEG
SERAEGALRSPGSCCAKCKKRVQFADALGLSLASVKHFSETEEPQVPPAVLSRFRSFPARAEDLEQLPSLLAAAAAAAPLPAPPPRLQPLFELPEPSAVAERLRRQRVCL
ERVHCSEPGGVEVTGSGRVLGCPGPRAVAVRYTFTEWRSFLDVPAELRPEPGEPPPLAPSRGPGDAEDEPGAERFHFALCLPPGLLPKEGEDADAPGVAVHFAVCYRCAQ
GEYWDNNAGANYTLRYVRPADAL*
36 >lcl|XP_003128673.1|Plus1complement(592177..594411) NW_003535264 disintegrin and metalloproteinase domain-containing protein 20-like LOC100525589 __SEG__ Chr7 {Sus scrofa} MGPASAQAQLRGDPCLPLLWLFLGPICCSYAPPGWRFTASEIVIPRKVSHRVSTAEIQGQLSYKIRFGGQRHVVHMRVKKSLLPRHFPVITDNDQGAMQEDYPFVPRDCY
YYGYLEGVPGSMGTLDTCHGGLRGMLQVDDFTYEIKPLEASSKFEHVISLLVTQKTPGEDEKCKIGGEDTNQADEEALLAEMPRAGPVYMWWPHRKYIKLLYTVAHSYFL
LNPNQTSVIENVVIMNNILHSIYFQAGFDICIRVLCIWNAGERINFDNVPNGGAAVSDFGLWKMYRWYYSIPHDTAVLLTGHRFGNDTYFGSHSGICNPNWGASFVCVGN
NHIFLASTLAAHALGHVMGCTHDVPGCRCFRRDKCVMAPETGLLDMLSNCSYVTLHEVVHRWDPCLSEANVPYDNFPYVANRCGDKKLDAREECDCGTMKDCAEDPCCEN
SCILTLGSTCSEGSCCVGCNYAQPGRMCRDVLGICDLPEYCTGLTHTCPDDSYIQDGTPCSPLAVCVKGNCSDRNMQCQALFGVKVKEAAPICYSTLNMRGDRFGNCGVR
VVEGGGKPVKCEEDDIMCGMLHCANVQKIPAGGAHTTFRHIVVHDVTPKTCFGFDAHFGTLTPQLGLVVDGASCGPGQFCKDQNCTFYPDLNFSCDVSTCNFRGVCNNRR
HCHCQQGWKPPNCDVEGGGGSVDSGPPPDKRKETRAKIRTNVKIELALVLARFALLFVSCIIGSLFYLKEIVDQRYEETASEKS*
37 >lcl|XP_003128686.1|Plus1complement(402563..404755) NW_003535264 disintegrin and metalloproteinase domain-containing protein 20-like LOC100514528 __SEG__ Chr7 {Sus scrofa} MGPASAQAQLRGDPCLPLLWLFLGPICCSYAPPGWRFTASEIVIPRKVSHRVSTAEIQGQLSYKIRFGGQRHVVHMRVKKSLLPRHFPVITDNDQGAMQEDYPFVPRDCY
YYGYLEGVPGSMGTLDTCHGGLRGMLQVDDFTYEIKPLEASSKFEHVISLLVSQKTPGEDEKCKIGGEDTNQADEEALLAEMPRAGPVYMWWPHRKSLKMHYTVSYSLYL
QQTNQTLIVENVMILNNIVHSIFLYNLVEVHVRLLCIWTRTEKFEVGARKWRSIDNAVAHFGYWEINLHNLHPRDCSILFTGDKAHHANYFAFKSGLCKPNWGSSYIFLA
RYHIFMGASLSAHVICHLFGCDHDTSGCHCFRRAKCVMAPEPGFLDVMSNCSYGSLASWVNGRWDGCLSARNIPYDNIPYVAPRCGDKIRNLREDCDCGTLKDCAKDKCC
ESHCVFTLGSSCYQGPCCIDCKHAQPGKVCRDVLGICDLPEYCTGTTHACPRDSYIQDGTPCSPLAVCVRGNCSDRDMQCQALFGFKIKDAAPACYKTLNVKGDRFGNCG
VKPHQGGSRPVPCELDDIYCGLLHCTAISKIPSGNEHTTFRHILVHDVKPQTCFGFDAHHSSQVPEMGLVVDGASCGPGKYCKDQNCTFYPDLRFDCDVQKCNFRGVCNN
RKHCHCQQGWKPPNCSAVGAGGSVDSGPPPDKHMYSGTKIVTEIDKELVLLLLRFFLFLLSVVVGALFQL*
38 >lcl|XP_003129043.2|Plus1361441..362790 NW_003535367 tripartite motif-containing protein 75-like LOC100513415 __SEG__ Chr8 {Sus scrofa} MAVAAALAGLQAEAKCPICLDSLHDPVTIQCGHNFCRRCIQRSWAELEDTFPCPMCRHPCLEPHVRSNTQLGRMIEVARLLHSSRSSSKMSQQPHLCEWHNQVLSLFCEN
DLEVLCPLCAQTPSHQGHVMRSVAEAAADHLQKVSSYVEPLKRQVAETQGLLAMQDIKLLELQEQVQHRQLELASEVRQMSRAVDHEQELVLARLVQEEHNIHEQLVTNI
AAFSGHIWELWGLLQEMREQSCSFSPQYSVLQKIAQKFTEDVILDPETAHPNLLVSEDRKSATFMRMRQMVLKAGRFRLEPAVLGSVGFGHGRRYWEVRVDGATWAVGVC
MDTAPRARSRHMEGQSCYWTVGQRRGDYQAWGPAGILPLELKEDPCGIGVYLDYELGVISFYNLKDRSHIHSFTDSFSGVLKPYFCVGCDSRPRTLSSVIEHEGASVTLP
PFLPEVYGQ*
39 >lcl|XP_003129044.1|Plus1complement(345582..346967) NW_003535367 tripartite motif-containing protein 60-like LOC100513607 __SEG__ Chr8 {Sus scrofa} MAQAASLAQLQAEASCPICLDYLQDPVTTDCGHNFCHSCLLQRWEGLQGDFPCPVCLQHCPDRSLRRNTQLCHMVDVVKQLPNMEGEGKQQEEKALCLKHHQVLSLFCEE
DLELLCPQCKISSHHGGHLVVPMEPAAACHRRRLKGSIEPLKEQHEVAKKALEMQVSKTFDLMREVQKQRSKLQSEVEYMKHFLNKEHDAIHFRLLNNGKDVQDKIIESR
NQISDHSSRLKSLLDEITKKCLQRDLDLLMGIERIYSTYKNLESPAGFSYELKKEIFTLPPQYFGLHKMITTFQEYLTLDAGTAHNSLFITKDRKTATFQRMKLNCFYNP
QAFTSHPAVLGSEGFNAGRHFWQVEGRGLGEWSLGVCKESFPRNVPIPPTPDNGCWKIQVRATTSGTGDLENSRRIGVFLDCELGEVSFYNLIERSLLYSFSAIFTGKLM
PYFSVGSSSTSVTLNLVEDEV*
40 >lcl|XP_003129498.1|Plus119654..21495 NW_003535487 ubiquilin-like protein-like LOC100517175 __SEG__ Chr9 {Sus scrofa} MPHVITRTPRTAQGGRPARLPADKSSSSSVTQVIIKTPGKQENFTIADDTSVRQFKEKLSAHFKCQVDQLVLVFMGRLLKDHDTLSRRGVLDGHTVHLVIKSKHGSRSLA
HSTRNPSTKDPSHQDRTRQGNSTGVDQPASVGHSPVEPALSAEPDVPKAHTRDQDVGRPEHLTQILENASTQRLLSNADLMRQFISEHPDMQQLMQQNPEVSHILDSSEL
LRQTLELARNLAVIQEIMQIQQPAPSREHPLNPQSCVGLESIPRVQTSPGQGSADFSDEVLNPSQDPFGGNPFTALLGGQVPGQVQSSPPSPPPQEWGEQLPQLPTTRVI
YASSRAFSSVTPASATPDKSHHTSRAFTSTNSTNSRSHTGTVEKPAGVSVLPSVEVTQQPQAEDKDATISLDSSGQKLEDALQLSDEQSSSPITGSLMQLLLNNPSLAAQ
MMLCVSMPQLSQQWQQQLLAFLQQTQLSETLIALGNPKASQAILQIEQGLQLLATEAPVLLPWVAPYLWGLGWLPAPSCSYPDTVPWAWDTPDMAKPNGPEACHKSGTVL
QRLQSLAGDPAHLLQAPEIRFSKQMESLRAMGFGNQHANLQALIATEGDSSAAILRLRRSQAF*
41 >lcl|XP_003129502.1|Plus1113721..115562 NW_003535488 ubiquilin-like protein-like LOC100517904 __SEG__ Chr9 {Sus scrofa} MPHVITRTPRTAQGGRPARLPADKSSSSSVTQVIIKTPGKQENFTIADDTSVRQFKEKLSAHFKCQVDQLVLVFMGRLLKDHDTLSRRGVLDGHTVHLVIKSKHGSRSLA
HSTRNPSTKDPSHQDRTRQGNSTGVDQPASVGHSPVEPALSAEPDVPKAHTRDQDVGRPEHLTQILENASTQRLLSNADLMRQFISEHPDMQQLMQQNPEVSHILDSSEL
LRQTLELARNLAVIQEIMQIQQPAPSREHPLNPQSCVGLESIPRVQTSPGQGSADFSDEVLNPSQDPFGGNPFTALLGGQVPGQVQSSPPSPPPQEWGEQLPQLPTTRVI
YASSRAFSSVTPASATPDKSHHTSRAFTSTNSTNSRSHTGTVEKPAGVSVLPSVEVTQQPQAEDKDATISLDSSGQKLEDALQLSDEQSSSPITGSLMQLLLNNPSLAAQ
MMLCVSMPQLSQQWQQQLLAFLQQTQLSETLIALGNPKASQAILQIEQGLQLLATEAPVLLPWVAPYLWGLGWLPAPSCSYPDTVPWAWDTPDMAKPNGPEACHKSGTVL
QRLQSLAGDPAHLLQAPEIRFSKQMESLRAMGFGNQHANLQALIATEGDSSAAILRLRRSQAF*
42 >lcl|XP_003129503.1|Plus1118408..120366 NW_003535488 ubiquilin-3 UBQLN3 __SEG__ Chr9 {Sus scrofa} MARSGEALPQGSPAPVPDPHLIKVTVKTPKDKEDFSVTDTCTIRQLKKEVSQRFKAHPDQLILIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTVGAECPAASAPGP
AAPSPGPLPQPSSIYPGDGPSPFSVGVLAGLQGLGLTSGSFPDQPSSLTGQQVSTPGFVAQITDDPFIQGLLSNTGLAHQLVLDNPHVQQLIQHNPEIGHILNNPEIMRQ
TLEFLRNPAMMQEMMRSQDRALSNLESLPGGYNVLRTMYTDVMDPMLNAMQEQFGANPFAPTTMAKATTSSSQPSRTENRHPLPNPWASTCAGSGGRRGGRPEDRDVSEP
RTRVPNILGHLGLCDPLQQLHETPLSLGTYLQGMASALSPSQEPPLPPQGSQPPPTSPSSQESGSGQAPPRESVAVKGKPTCPGFLRYPPERGPRKDGDRSGAGNGSTLP
DLVSGLGRAANRAPCVPSPPSPMAATAGIPEHAWWPPPAYPRSLRPDSMSQVPQLQDEMHWQLPLLLHLQAAMANPRAMHALLQIEQGLQILATEAPHLLLWFMPCLAGL
GSMAGGAEPREGTLLPDDPPTPAAPGVSSTQDTELGLHPPPFLQILQALAGANSQQLPPETPFRVQLERLRAMGFLNPEANLQALIATGGDVDAAVEKLRQL*
43 >lcl|XP_003131452.1|Plus1complement(605043..605525) NW_003300909 heat shock protein beta-9-like LOC100524041 __SEG__ Chr12 {Sus scrofa} MQRVSSGLPNGSQSASRCASVAFTEQNQVATLPVQQLTDDVAAMRDNVHAEDGFQMKMYAHGFTPEELVVQVDGGCLMVTGQRQLEGCSPDGSGFRMAQKVHQQMPLPPG
LDPAAMTCCLTPSGQLCVRGQCRALPCPEAQTGPAPRLRSRGSKKGSKLA*
44 >lcl|XP_003132456.1|Plus1142943..143638 NW_001885339 dnaJ homolog subfamily B member 8-like LOC100517496 __SEG__ Chr13 {Sus scrofa} MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDRAGCDSWRAGGASTPYSSPFDSGYIFRNPEDIFREFFGGLDPFS
FDFWDTPFVSDRGGRGHGLRGAFSAGFGEFPAFMEAFSAFDTLGRGVGGAGRTTFSSTSFSGSGSSGFKSVMSSTEMVNGHKVTTKRIVENGQERVEVEEDGQLKSVTIN
GKEQLKRVDSK*
45 >lcl|XP_003132533.2|Plus1complement(174560..174994) NW_003301112 WW domain-containing transcription regulator protein 1-like LOC100523282 __SEG__ Chr13 {Sus scrofa} MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGNPAQQH
AHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLK*
46 >lcl|XP_003132759.1|Plus1348305..348625 NW_003301176 glutaredoxin-1-like LOC100524528 __SEG__ Chr13 {Sus scrofa} MAQAFVNSKIQPGKVVVFIKPICPYCRKTQELLSQLPFKEGLLEFVNITATSDTNEIQDYLQQLTGARTVPRVFTGKECIGGCTNLVSMYERGELLTHLKQTGALK*
47 >lcl|XP_003133445.1|Plus1complement(143868..144722) NW_003536414 protein phosphatase 1 regulatory subunit 3B-like LOC100515931 __SEG__ Chr15 {Sus scrofa} MAVDIECRYSCMAPSLRRERFTFQISPKPSKPLRPCIQLSSKNEASGTVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPLNITELLDNIVSLTTAESESFV
LDFAQPSADYLDFRNRLQTDHVCLENCVLKDRAIEGTVKVQNLAFEKMVKVRMTFDTWKSFTDFPCWYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQTY
WDSNKGKNYRIIRAELKSTQGTAQPQNGPDFGIALDQFGSPRCSYGLFPEWPSYLGYEKLGPYY*
48 >lcl|XP_003133903.1|Plus1863400..864086 NW_003536521 brain acid soluble protein 1-like LOC100522108 __SEG__ Chr16 {Sus scrofa} MGGKLSKKKKGYNVNDEKAKDKDKKAEGAGTEEEGTPKENETQAAAETPEVKEGKEEKPEKDAQDAGGKPDDKEGEKDAEAAKEDAPKAEPEQTEGAEGKQETPKDAEQE
AAAASGPAAGGEAPKASEAEAAEPAALTKDDKSKEAGEPTKTEAPAAPAAQETKSDGAPASDSKPSSTEAAPSSKETPAATEAPSSTPKAQAPAAPADEVKPAETPAANS
DQTVAVKE*
49 >lcl|XP_003134015.1|Plus1688446..688898 NW_003536551 heat shock protein beta-3-like LOC100519061 __SEG__ Chr16 {Sus scrofa} MAKIILRHLIETPVRYEEEFEARGLEDCRLDHALYALPGPTTLDLGKARATQAPPVDSAAEGPPQKGECRFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFI
SRSFTRQYKLPDGIETKDLSATLCHDGILVVEVKDPVGTK*
50 >lcl|XP_003134416.1|Plus1complement(156802..158010) NW_003301640 zinc finger CCHC domain-containing protein 3-like LOC100519451 __SEG__ Chr17 {Sus scrofa} MATGGGAEEERKRGRPQLLPPGRPAPRAEEAEGGREKMGWAQVVKNLAEKKGEFRESRPPRREEEGGAGGGLCAPAGLAAPGLGDFPPAGRGDPKGRRRDPAGEAADARK
KKGAAEAGRRKKAEVAAMAGPSRPGAAEDAAERPPQDETAAATGPGAGPGKGRFLVRICFQGDEGACPTRDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEK
LALFLRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQ
PKTCFKCGSRTHMSGSCTQDRCFRCGEEGHLSPYCRKGIVCNLCGKRGHAFAQCPKAVHNSVAAQLTGVAGH*
51 >lcl|XP_003134554.1|Plus1complement(5417255..5418154) NW_003536672 protein phosphatase 1 regulatory subunit 3D-like LOC100521997 __SEG__ Chr17 {Sus scrofa} MSGDPGSAVPPAAPAFRKPAPRSLSCLSDLYGGAAPEPRPCRPPGSPGRAPPPPTPPSGCDPRLRPIILRRARSLPSSPERRQKGAGAPGAACRPGCSRQHRVRFADALG
LELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLQCLVPDFPPPVEAPDFGERLGRQLVCLERVTCSDLGISGTVRVRNVAFEKQVAVRYTFSDWQSAHEAG
ARWRGPAGAEGAEDVFAFGFPVPPFLLALGSRVHFALRYRVAGAEYWDNNDGRDYSLTCRNHALHMPRGECEESWIHFI*
52 >lcl|XP_003134781.1|Plus12614305..2615216 NW_003536705 RING finger protein 148-like LOC100510940 __SEG__ Chr18 {Sus scrofa} MNLLRITPSIHRSLSSGLLRLNIFLLLSLPVSKGKAIWTAHLNITFQVGTRIISELGESGVFGNHSPLERVSGVVVLPEGWNQNACNPMTNFSRPEWADSWLALIERGGC
TFTHKINVAAEKGANGVIIYNYPGTGNKVFPMSHQGTEKTVAVMIGNLKGMELLHLIQKGVYVTIIIEVGRMHMPWLSHYVMSLFTFLAATVAYLFLFCAWRPRVPSSPT
RRRRHIKADVRRAIGQLPLRVLKDGDKELDPEEDSCVVCFDIYKPQDVVRTLTCKHFFHKACIDPWLLAHRTCPMCKCDILKP*
53 >lcl|XP_003135081.1|Plus1complement(160194..160802) NW_003536774 protein phosphatase inhibitor 2-like LOC100517069 __SEG__ ChrX {Sus scrofa} MAAPTASHGPIKGILKNKGSTASSVAASVQQAGGAVAEVQRKKSQKWDEKNILATYRPEYRDYDFMKTNEPSTPQLGLLEDPEDAACDSATKETLTLDNLAKKLAATDTS
ELSYHLGEPEREGAHTSKIFLDKQEKHRQFEMKRKLHYNEGLNIKLARQLISRDLEREEEEDENKESRHVTSQDKTTLGELEEGPASDELQT*
54 >lcl|XP_003135158.1|Plus1265144..267276 NW_003536786 ubiquitin carboxyl-terminal hydrolase 51-like LOC100519179 __SEG__ ChrX {Sus scrofa} MAQVREASLPLGSLVRCSSGDGRGASPEEGAEKAGEMEEEELGAAKAYSGPGAVEMKLEPSQEHKPAPEENFTWSGSCSDEKVLPSNPLRCYSSSLTLCPRRKPRPRPQP
GTHFLGPPRSWAPPPPPSRPPPPPPPRPRPSPRPWRRSQRRSGPRYRPQTPRSCSSDLGGSGDPDSLGDWLLEVEFDQQGPTGCSHVESFKVAKNWQKNLRLIYQRFIWS
GTPETRKRKAKSCICHVCSTHMNRLHSCLSCVFFGCFTEKHIHKHAETKQHNLAVDVYHGVIYCFICKDYVYDKDIEQIAKETKDKVSKLLTSTSSDVSQQQCMTSGVEE
KQLTCESKEQEPKLVKPKKKRRKKSVYTVGLRGLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAMYSGNRTPHIPYKLLHLIWIHAEH
LAGYRQQDAHEFLIAILDVLHRHSKEDSVGQEASNPNCCNCIIDHIFTGGLQSDVTCQVCHTVSTTIDPCWDISLDLPGSCATFSCQNPERADGTVSRDERIPGNPSLTD
CLQWFTRREHLGSSAKIKCSSCQSYQESTKQLTMKKLPIVACFHIKRFEHVGKQRRKINTFISFPLELDMTPFLSSTKESKMKERQPQTDYAPIENKYSLFAVINHHGTL
ESGHYTSFIRQQKDQWFSCDDAVITKATIEDLLYSEGYLLFYHKQGLEKD*
55 >lcl|XP_003135205.2|Plus1708271..709140 NW_003536796 OTU domain-containing protein 6A-like LOC100517870 __SEG__ ChrX {Sus scrofa} MEDSQSEHQRMIRRHNREKKELQARIQSMKNSVPRSDKKRRKQMLLDVARLEAEMEQKHQQELEKFQESFPGNLDSVTEDLAKMDLENQPPRPSRAQRRRERRAALARER
QERIAEAEMEHLASFRKDEEEKLRAILGAKNLEMKDIPADGHCMYRAIQDQLVFSVTVESLRRRTAEYMQKHVDDFLPFFSDPETGDSYSRDDFLSYCDDIVRSASWGGQ
LELRALSHILQTPIEVIQANSPAVVIGEEYTKRPLILVYMRYACSLGEHYNSVKPLEAGAVGGAPPRLF*
56 >lcl|XP_003135208.2|Plus1complement(314510..316417) NW_003536795 e3 ubiquitin-protein ligase Praja-1-like isoform 1 LOC100518407 __SEG__ ChrX {Sus scrofa} MGQESSKPIWPKPAGGYQSNTDRRYGRRHACVSFRPSTSQQERIFGQRKTPSEVPMHRSAPSQTTKRSRSPFSTTRRSWDDSESSGTSLNVDNEDYSRYPPREYRASGSR
RGMAYGHVDCFGADDSEEEGAGPVERVPVRGKTGKFKDDKLYDPEKGARSLAGVPPRFSSFNRDVRDELDKLDPAPAARRSANRAEFLQPNSMTSQPPSAEGKVVTNGNS
LERERREQNLPVRPSRAPVSICGGGENTPKSAEEPVVRPKIRNLASPNCVKPKIFFDTDDDDDMPHSTSRWRETASAEEGHSDGLARRGRGESSSGYPEPKYPEDKREAR
NDQVKPEKVPRRRRTMADPDFWTYSDDYYKYFEEDSDSDKEWTAALRRKYRGREQNMSSSGESWETLPGKEEQDTEQARVNAGAGASPSAGASAGSSGSSELEEVRGPSV
QEEEQASPEEGEVPWLQYNENETSSEGDNDSGQEFLQPGVFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESL
AVDVEVANPPASKESIDALPEILVTEDHSAVGQEMCCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL*
57 >lcl|XP_003135271.2|Plus1complement(956958..957401) NW_003536815 ubiquitin-conjugating enzyme E2 D2-like LOC100525551 __SEG__ ChrX {Sus scrofa} MALKRIHKELLDLSRDPPDQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPSDYPFKPPKIAFTTQIYHPNINRNGNICLDILRSEWSPALTISKVLLSICSML
CDPNPDDPLVPEIAKIYTKDRRKYDRIAREWTEKYAM*
58 >lcl|XP_003135329.2|Plus1115392..115706 NW_003536831 WW domain-binding protein 5-like LOC100513331 __SEG__ ChrX {Sus scrofa} MKPCQKIEGKPENESEPKFEEEPKPEEKPEEEEEPEEEEKSEGTFKERLIQSLQEFKEDIHNRHLSKEDMFREVNEIDEIRRVRNKLIVMRWKVNRNHPYPYLM*
59 >lcl|XP_003135386.1|Plus11876175..1877209 NW_003536841 RING finger protein 113A-like LOC100514886 __SEG__ ChrX {Sus scrofa} MAEQLSPGKTTDQVCTFLFKKPGRKGAAGRRKRPICDQESGDSSSSSDEGSTVVRPEKKRATHNPMIQKTRGSGKQKAAYGDLSSEEEEEENEPESLGVVYKSTRSAKPV
GPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKF
LHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDEEEIPFKCFICRQTFRNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRAAEEGGAS
DFPEDTDEGPIPIT*
60 >lcl|XP_003135408.1|Plus1complement(150639..152033) NW_001886682 DDB1- and CUL4-associated factor 12-like protein 2-like LOC100521308 __SEG__ ChrX {Sus scrofa} MAPQQTGSRKRKAPALEAAAAGSSSQGSAAAADGDGPLLPKKPKRPAARRSLLHYLKGREVGARGRAGLPGFEGELRGYAVQKLPELLRERELALGTLNKVFASQWLNAR
QVVCGTKCNTLFVVDVQSGQITRIPLMRDRAPGPARAQPSCGIHAIQLNPSKTLLATGGENPNSLAVYQLPTLDPVCLGDRHGHKDWIFAIAWMSDTVAVSGSRDGTVAL
WRMDPDVFQGSIAWHNNAGLPVYAHIRPRDVETIPRASTNPSNRKVRALAFSGKNQELGAVSLDGYFHLWKARSTLTRLLSIRLPYCRENVCLTYCDELSLYAVGSQSHV
SFLDPRQRQQNIRPLCSREGGTGVRSLSFYQHIVTVGTGHGSLLFYDIRAQKFLEEKAWATPHSSPGPAGRKLKLTCGRGWLNHDDLWVNYFGGIGEFPNALYTHCYNWP
EMKLFVAGGPLPSGLHGNYAGLWS*
61 >lcl|XP_003135444.1|Plus179021..81486 NW_003535336 hypothetical protein LOC100514620 LOC100514620 __SEG__ Chr8 {Sus scrofa} MFRVNKAWLVLSPRQALRILSISPTANLTPASIKKAYIQQTLQCHPDLHPNDPNANENFRNLSDAFRIALKTLELKHGGDALRGQQTADGRRGLSDEDLYDPQAALESLR
QAMWAYRTHQQLSEASSSPPPARTTTRASSHPSLDPTQDTAGGFFDTPTLEDVSSVCQREAVAMRRVHSFCTDLPAVLCGSHSAALFEAVAFFYARYVESMSACVMRFSQ
NLPILVRRVVKNRRRNVDNKSAAVVKGIGTGSRPLERQRIEDMAMKPLVLMGALIFDLPDGAATSSARDGGSPTSRGFDRNSSSSTCGVSQPSDIHVTSELKCVIYPADS
IADITAKLGKWEAASFERLKVELAIVDVNRLLSGMLGLQDEEVPSQSSAHLSVMPHLAETRAATEMVLRTLQKNATGLCFYLDPALDATVDESVVAAMRLHDTPDTSPSQ
QDDAAAASLELPVLVAHCRRLATLARPMIRGNIILTWKSGETVELVKDAAELAETAPTAENVRDKQPQDQQTTKDDTPTFSVGRHLTCSTAETVFFSVSVVLTKDLRTFL
LRLRCALKRVLQATNESKRILSELLPLREATLKEEYIASAPLADDADADSPYSYRGPIHCFPRVCNMGTKREYQLWKHLHTHREYIAKHASTMNPINIFYECFPYDPESP
EYHPPTADAPTDVLAGWVSSSADGCDNVVITAQELDDPVHFKEWLEEVVAQSSLSREAGELLARAGVGYVSRDPALPLANFLSFAKVYVRSLAVRSVLEQRNGRGHVGGT
ATPDTTGLSIIVSPSRCDVCDGGRLFIPWYVDPSILLALLGDHAPQHQLHA*
62 >lcl|XP_003135446.1|Plus1complement(244177..246891) NW_003536853 ubiquitin carboxyl-terminal hydrolase 26-like LOC100515989 __SEG__ ChrX {Sus scrofa} MAALVAHGFVQIWSRKTGMSKSKEAFIQTVERKSKVRLVVYFRTGEHTTFRLSNNIKSVVLRSYGKKQNHVHLTFQDNSFLFIEKLSSRDAENLKAFLDRVHENNLQPPI
RPDRDGSVFASTAVRKPVNKTSFHKTCKKSGSPSFEKGGKNETPDLEKMPLFASKSSTLTWEELLENGYGKRKKMLSSGSEMNRNFLKENIFVRKKRSKTNPFRHASHKE
RKESRLKQNKKLEFGPSFKISSTGKPYLDGVGLLQMLTKNIYLAFLSESKYGEDDPDWDKLKMTLDFYPEKLWQGFPNLGNTCYMNAVLQSLFSIPSFADDLLSQGFPWG
KIPLDALNMCLAQLLVLKDIYNIKIKERLLVNIKKAISAVAEIFSDNIQNDAHEFLGQCLDQMKENMGQLNSIWETTFESEQGDSPQQVLTGSTATEMLVCPVITNFEFE
LLCSIVCKACGQVVLKTEVSNYLSINLPQGTEALPLSIQSSFDHFFGAEELEYQCEKCKHRGSVAVHKFGRLPRVLIVHLKRYSFNEFWSLKKDDQEVIISKYLKLSSHC
SESTKPPLPLSKNAHIREFQILKIFQRINSEIFGLSTPSAEPTSESKDSLAAHIGSEKEAESQKYQILDKGLSGEQQKDLGKSTPNVMDSTLLNSGDGAAIARELLAVSL
MMDLEDNFLSPKGKPTSSTCQEVPENPKLKKCKRSNMFVDLEGVTETIKHVCKDKPSRISEVFHQESEQAQQYERLRLYEQALWLALLQSLPKPGARYTKNPRRPTEVHF
QGADVNSLGALGSDKNPGNKKCLDRKTEPETKKPKRNAEMEDPHAYRLIGVVSHLGKTPNSGHYISDAYDFERQVWFTYNDLQVSSIQEAPMQEARLCTGYIFFYMHNEI
FEELLEREENSQPHSTEAGKTPRE*
63 >lcl|XP_003353428.1|Plus1856405..858462 NW_003534012 leucine carboxyl methyltransferase 2 LCMT2 __SEG__ Chr1 {Sus scrofa} MGPRSRERRAGAVQSTNDSSALSKSSLAARGYVHDTFAALLVPASVRRAPLIHRGYYVRARAMRHCVCAFLEGTRAALGAPHIQILSLGAGSDSLYFRLKAAGRLPGAAV
WEVDFPDVARRKADRIRDTPELCALTGPFRRGDAGSTLCFESSDYRILGLDLRQVQRLDQALAAAGLDAAAPTLLLAEAVLTYLEPNNAAALIAWAAQCFSDALFVVYEQ
MRPHDAFGQFMQQHFRQLNSPLHGLDRFPDAEAQQQRFLQAGWTACRALDMNEFYRHFLPAEERRRVENLEPFDEFEEWHLKCSHYFILAASRGDIVSQTVVFPASETFP
RIDPASPSGVIPARVVTSDSQGPDLKRYGHASVLLSPDVILSAGGFGEEEGRHCRVSKFHLLSRYCDFEWKGNQVCSWGTGAQWDRRLYHTMTRLSDTQVLVLGGRLSPV
TPALGILQLHFGKHVGGKTEGLNITVTKVGPEDSTVSCWRHSTTEVSYKNQKYLFVFGGRGVADPVLSDWHFLHVGTMAWVRIPVEGEAPEGRHSHSACSWQGGALIAGG
LGASEEPLSSILFLKPISSGFLWEPIAIQPPVTPRYSHTAHVVNGKLLLVGGVWIHSSSVPGVTVIDLSTGLSSEYQIDTIDVPWPLMLHNHTSILLPEEQQLLIIGGGG
NCFSFGTYFNPHAVTLDLSSLSARQ*
64 >lcl|XP_003353662.1|Plus1complement(64009..64581) NW_003534153 RING finger protein 183-like isoform 1 LOC100622036 __SEG__ Chr1 {Sus scrofa} MAELQGREPECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAVLTLLRLEPHHVILEGRQLCLKDQPKNRYFLRQ
PRVYTLDLGPEPASQAGLPQDTAPTSRPAPSPSPSRSSLRQCFRNPQFRIFAYLMAVVLSVTLLLIFSIFWTKQFLWGVG*
65 >lcl|XP_003353772.1|Plus1126669..127013 NW_003299439 notch-regulated ankyrin repeat-containing protein-like LOC100620133 __SEG__ Chr1 {Sus scrofa} MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYS
GSGR*
66 >lcl|XP_003353906.1|Plus1complement(380107..380427) NW_003299464 glutaredoxin-1-like LOC100622726 __SEG__ Chr2 {Sus scrofa} MAQAFVNSRIQPGKVAVFIKPTCPYCRRTQKLLSQLPFKEGLLEFVDITATSDTNKIQVYLHHLMGARTAPRVFMDEECIGGCTDFVSMHERGELLTHLKQIGALK*
67 >lcl|XP_003354105.1|Plus1730573..730980 NW_003534272 tartrate-resistant acid phosphatase type 5-like LOC100625378 __SEG__ Chr2 {Sus scrofa} MDTWTVLLILQASLVLPGAVGTRTDTRTAPTPILRFVAVGDWGGVPNAPFHTAREMANAMGIATTVKTLGADFILSLVDNFYFTGVHDASYQNLQMCSHLSEDPFSLLFS
SGPLPTESPQLRTEASSLATRTPLI*
68 >lcl|XP_003354616.1|Plus1complement(160946..161545) NW_003534426 heparan sulfate glucosamine 3-O-sulfotransferase 4-like LOC100626364 __SEG__ Chr3 {Sus scrofa} MEKTPSYFVTNEAPKRIHSMAKDIKLIVVVRNPVTRAISDYTQTLSKKPEIPTFEVLAFKNRTLGLIDASWSAIRIGIYALHLENWLQYFPLSQILFVSGERLIVDPAGE
MAKVQDFLGLKRVVTEKHFYFNKTKGFPCLKKPEDSGAPRCLGKSKGRTHPRIDPDVIHRLRKFYKPFNMMFYQMTGQDFQWEQEESDK*
69 >lcl|XP_003354980.1|Plus1complement(432591..433049) NW_003534555 14-3-3 protein theta-like LOC100622910 __SEG__ Chr3 {Sus scrofa} MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLVSVRPSGGGRPG
GGSRGAVRPGAPGPLCVRPSLENFTGTESGRAFPDCLPTSRV*
70 >lcl|XP_003355125.1|Plus1complement(226863..227300) NW_003534657 ubiquitin-conjugating enzyme E2 D3-like LOC100155452 __SEG__ Chr4 {Sus scrofa} MALKRIDKELSARDPPAQCSAGPVGDAMFHWQATVMGPNGSPQRGCVFFLTIHFPTDYPFKPPEVAFTTRIYHLNINSNGSICLDILRSQWSPALTISKVLSSICSLICD
PNPDDPLVPEVTWIYKTDRDKYNRISWEWTQKYVM*
71 >lcl|XP_003355790.1|Plus1complement(125764..125874) NW_003534889 WW domain-containing oxidoreductase-like LOC100520026 __SEG__ Chr6 {Sus scrofa} MAALRYAGLDDTDSEDELPPGWEQRTTKDGWVYYAK*
72 >lcl|XP_003356124.1|Plus1complement(288927..289247) NW_003534965 glutaredoxin-1-like LOC100620573 __SEG__ Chr6 {Sus scrofa} MAQASVNSKVQPGKVVVFIKPTCPFCRKTQKLLSPLPFKEGLLEFVSITATRDSSKIQDYLQQLTGARTVSRVFIGKECIGGCTDLVSMHERGRLLTRLEQVGALK*
73 >lcl|XP_003356782.1|Plus1328591..330501 NW_001886521 heat shock-related 70 kDa protein 2-like LOC100621324 __SEG__ Chr7 {Sus scrofa} MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKG
EIKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIF
EVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLD
KGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSS
VLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTY
NIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGGTGASGGPTIEEVD*
74 >lcl|XP_003356978.1|Plus1complement(270847..272229) NW_003535367 tripartite motif-containing protein 60-like LOC100621782 __SEG__ Chr8 {Sus scrofa} MAQAASLAQLQAETSCPICLDYLQDPVTTDCGHNFCHSCILQRWEDLQGDFPCPVCLQHCPDRSLRRNTQLCHMVDVVKQLPNTEGEGKQQEEKPLCEKHHQVLSLFCEE
DLELLCPQCQVSCDHQDHHLVPMEQAAACHRKRLKGSIEPLKKQLEEADMALDMQVSKSYELLWRVEHKKRNLHRDVEHIKDFFEKEHNEIHVRLLNEESDVKDKIIGSE
HQISEQESTLKSLLSEITGRCVQPDLDLLTGIERIHSTYENLESPAGFSYELKKEIFPLPPQYFGLHKISTFQEYLTLDAETAHCSLIISQDGKTATFQGLEPNSVHKSK
AFTSHPAVLGSEGFNAGRHFWQVEGRGLVEWSLGVCKESFPRNVPIPPTPDNGCWRIQLRATTPGTGDSGNSCRIGVFLDYELGEVSFYDLYKRSPLYLYSAIFTGKLMP
YFSVGSSSTSLTLNLVEDEV*
75 >lcl|XP_003357194.1|Plus1complement(371531..372004) NW_003535486 tripartite motif-containing protein 6-like LOC100622028 __SEG__ Chr9 {Sus scrofa} MTSAVLVDIQEEVTCPLCLELLTDPLSIDCGHSFCQACITQNSEEWRMDQGGESSCPVCQTRYRPGNLRPNRHLANIAERLREVVLGSGTQLKVILCAHHGEKLQLFCRE
DGQLICWLCERAQEHRGHHTFLMEEVAQEYQVGPEEGRREGTDPFAD*
76 >lcl|XP_003357420.1|Plus1complement(242378..242803) NW_003535563 RING finger protein 11-like LOC100620318 __SEG__ Chr9 {Sus scrofa} MGNCLTPHTSEDLLVPASATHLGGRRRRARSRERRPRDQVPGWAPAAPLVQEEQVRVPQRISQIQCLPKGVYKRDGSQEKMEQEECAICTLDFVCGDPIRSLPCKHFYHL
GCIDEWLTRSFTCPYCRGPADGPQPSSRDTP*
77 >lcl|XP_003357421.1|Plus1complement(247457..247882) NW_003535563 RING finger protein 11-like LOC100620409 __SEG__ Chr9 {Sus scrofa} MGNCLTPHTSEDLLVPASATHLGGRRRRARSRERRPRDQVPGWAPAAPLVQEEQVRVPQRISQIQCLPKGVYKRDGSQEKMEQEECAICTLDFVCGDPIRSLPCKHFYHL
GCIDEWLTRSFTCPYCRGPADGPQPSSRDTP*
78 >lcl|XP_003357655.1|Plus1complement(37843..39870) NW_003300659 fidgetin-like protein 1-like LOC100625562 __SEG__ Chr9 {Sus scrofa} MQASSSRSAHLSEWQKHHFAVTSGTCTPGQKADAFRAQVLRIQYAWANAEISQVCAAKLFKKYAEKYSAVIDSDNVETGLNNYAEDILTLARSQQTDSDQWRSGLSINNV
FQMRSVQEMMEAGRKSRDSLLAPAAASVVIHRETVVSDLPKCSFWGTSEESDPLTNSACGTGGNQDIPEGSPMTCPRNAQPPLVANPTTTCPVLAPFGASGTVKAHAKPL
FGNVRKESTNAPKANTGLNVFSSDLSCFPSGCENPRERKALFSYSTTDALSTPVLHKAASKTEDNGQREEGSLPAFRTAREQLWVDQQKKAQQPQRAPGPLYGGVKKSLG
AGRSRGIFGKFVPPVPKQDGGDEGGGMQCKTSGAGPAEPARPVDERLKSLEPKMIELIMNEIMDHGPPVHWEDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGILL
FGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGAATSSEDRILVVGATNRPQ
EIDEAARRRLVKRLYIPLPEASARKQIVVNLMSREQCCLSEEEIDLVVGRSDGFSGADMTQLCREASLGPIRSLQAADIATITPDQVRPIAFSDFENAFRTVRPSVSPED
LQLYENWNRTFGCGK*
79 >lcl|XP_003357855.1|Plus1complement(374667..374981) NW_003535744 e3 ubiquitin-protein ligase RNF6-like LOC100624861 __SEG__ Chr11 {Sus scrofa} MLPILRLAHFFLLNEADGAERIRGLTKEQIDNLSTRHYEHSGRDSDLARICSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQPVLGSSTADDG*
80 >lcl|XP_003358346.1|Plus1complement(48266..48868) NW_003535925 heparan sulfate glucosamine 3-O-sulfotransferase 3A1-like LOC100625836 __SEG__ Chr12 {Sus scrofa} MAPPDPAGAHPTLPEPLSRRIFRKFLLMLCSLLTSLYVFYCLAERCQTLSRPVVGLSGGGEEARAPGRSVPAGGLGELAAWPAAARKKRLLQVQPWRKHRPPAPHGDGEE
AAWEEEPPGLAGSPGGSGAGSSVAEPPPGTLALLLDEGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYR*
81 >lcl|XP_003358381.1|Plus1complement(301033..301353) NW_003535937 glutaredoxin-1-like isoform 1 LOC100620288 __SEG__ Chr13 {Sus scrofa} MAQAFVNSKIQPGKVVVFIKPTCPFCRKTQDLLSQLPFKEGLLEFVNITATSDTNEIQDYLQQLTGARTVPQVFIGKECIGGCTDLESMHERGELLTHLEQIGALK*
82 >lcl|XP_003358386.1|Plus1complement(402297..402617) NW_003535937 glutaredoxin-1-like LOC100156011 __SEG__ Chr13 {Sus scrofa} MAQAFVNSKIQPGKVVVFIKPTCPFCRKTQDLLSQLPFKEGLLEFVNITATSDTTEIQDYLQQLTGARTVPQVFIGKECIGGCTDLESMHERGELLTHLEQIGALK*
83 >lcl|XP_003358855.1|Plus1complement(775718..776077) NW_001885237 ubiquitin-conjugating enzyme E2 B-like LOC100156381 __SEG__ Chr13 {Sus scrofa} MQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYHENKREYEKRVLA
IVEQSWNDS*
84 >lcl|XP_003358984.1|Plus1196494..197651 NW_003536138 LOW QUALITY PROTEIN: dnaJ homolog subfamily C member 28-like LOC100620748 __SEG__ Chr13 {Sus scrofa} MNTVYVVVARILRSHLIHVSMIPHQMNMGPYLGVLRTRMMSTYKSKKKMSEYYRLLNLDEGCSADDVRESFRKLAKQYHPDGGSSTADSATFIRIEEAYRKVLSHVIEQT
NARQSKVEADEEDEEKFKYKTPQHRHYLSFEGIGFGTPSQREKQYRQFRADRATEQVMEYQKQKLQSQYFTDSVTVKDVRHSKQQKITQAIERLVEDLIQESMAKGDFDN
LSGKGKPLTKFSGCSYIDPMTHNLNRILIDNGYQPEWILMQKEIKDTIEELREAILASRKKLGSPMSPTEQKQWNQVCEQFKKTSEN*TSELMILI*LFPC*PGRKSILM
HRKKLPEPRKPMRPC*RQKKSQIKTQMSSIREKGRKQLEPRQVSLTGRMCGDLLKS
85 >lcl|XP_003359505.1|Plus1123363..124916 NW_003536385 ubiquitin carboxyl-terminal hydrolase 17-like protein 2-like LOC100626328 __SEG__ Chr15 {Sus scrofa} MEVASLGWGQERLPNIFPPKRTSPWSAAAVDLPWGPSGPEKPSPSSQALCNQQADAAPVAAVGPVPTKGPLSWRPSVVGAGLQNLGNTCYVNAVLQCLTHTPPLAISLLN
GQHQRACQKQPFCMLCAVRAHVTRALLHPGDVIQPRKDLVASFHRHRQEDAHEFLMFALDAMQRCPSEDTLIQQIFGGCWRSQIQCLRCLGVSDTFDPYLDVTLDITAAQ
SVEQALRELVKAEKLDGENAYHCGVCLRKGPATKRLTLHRASKVLILVLKRFTDVTGDKMDKKVRYPEHLDLQPYLSVQKAGALDYELFAVLVHSGWTCHQGHYFCYIRA
GNGWWYRMDDSKVTACDTASALSQSAYVLFYIQRGELERATGGASADRAPRSPGADPIGRDAAVGEPRSPSSIRVSASEGPLAETDIQEITLEQWRRHQEHSRPKAEFNL
RKVEPALPTNAVVIHRSKFGDGTGRKLPAQENCGVSTSTRDAPPEGATNMGSIPCLEGRTKASKKKNKKKQRPLALQ*
86 >lcl|XP_003359952.1|Plus1complement(201352..202371) NW_003536627 mcKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin-like LOC100621298 __SEG__ Chr17 {Sus scrofa} MSRLEAKRPSLCKSEPLTSERVKATLSVLKGVVTSCYGPAGRLKQLHNGRGGSVCTTSQSAALLASLPVTQPILKILTTSVQNHVSCFSDCGLFTAILCCNLVEKVQGVG
LTTTTAIKLNKHLLSLCTEYLKSEICGCRIPIDFGSTQLLLCLVRSLLTSKPACMLTREEVEHISTLILRAFLLTVPENAKDRIILGKSIIVPLKGQRVIDSTVLPGVLI
EIPEVQVMKILPIKKSDSFKVALFCASLSGDLSETGEGTVVLSHGVSLENAVLDQLLNLGRQLVSDQVDLVMCQKVIHPSLKQFLRTHGVIAMDRVGVALMEPLSKMTGK
KHSAFAPYA*
87 >lcl|XP_003360395.1|Plus1complement(314510..316252) NW_003536795 e3 ubiquitin-protein ligase Praja-1-like isoform 2 LOC100518407 __SEG__ ChrX {Sus scrofa} MHRSAPSQTTKRSRSPFSTTRRSWDDSESSGTSLNVDNEDYSRYPPREYRASGSRRGMAYGHVDCFGADDSEEEGAGPVERVPVRGKTGKFKDDKLYDPEKGARSLAGVP
PRFSSFNRDVRDELDKLDPAPAARRSANRAEFLQPNSMTSQPPSAEGKVVTNGNSLERERREQNLPVRPSRAPVSICGGGENTPKSAEEPVVRPKIRNLASPNCVKPKIF
FDTDDDDDMPHSTSRWRETASAEEGHSDGLARRGRGESSSGYPEPKYPEDKREARNDQVKPEKVPRRRRTMADPDFWTYSDDYYKYFEEDSDSDKEWTAALRRKYRGREQ
NMSSSGESWETLPGKEEQDTEQARVNAGAGASPSAGASAGSSGSSELEEVRGPSVQEEEQASPEEGEVPWLQYNENETSSEGDNDSGQEFLQPGVFMLDGNNNLEDDSSV
SEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAVDVEVANPPASKESIDALPEILVTEDHSAVGQEMCCPICCSEYVKGEVATELPC
HHYFHKPCVSIWLQKSGTCPVCRCMFPPPL*
88 >lcl|XP_003360396.1|Plus1412957..414864 NW_003536795 e3 ubiquitin-protein ligase Praja-1 isoform 1 PJA1 __SEG__ ChrX {Sus scrofa} MGQESSKPIWPKPAGGYQSNTDRRYGRRHACVSFRPSTSQQERIFGQRKTPSEVPMHRSAPSQTTKRSRSPFSTTRRSWDDSESSGTSLNVDNEDYSRYPPREYRASGSR
RGMAYGHVDCFGADDSEEEGAGPVERVPVRGKTGKFKDDKLYDPEKGARSLAGVPPRFSSFNRDVRDELDKLDPAPAARRSANRAEFLQPNSMTSQPPSAEGKVVTNGNS
LERERREQNLPVRPSRAPVSICGGGENTPKSAEEPVVRPKIRNLASPNCVKPKIFFDTDDDDDMPHSTSRWRETASAEEGHSDGLARRGRGESSSGYPEPKYPEDKREAR
NDQVKPEKVPRRRRTMADPDFWTYSDDYYKYFEEDSDSDKEWTAALRRKYRGREQNMSSSGESWETLPGKEEQDTEQARVNAGAGASPSAGASAGSSGSSELEEVRGPSV
QEEEQASPEEGEVPWLQYNENETSSEGDNDSGQEFLQPGVFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESL
AVDVEVANPPASKESIDALPEILVTEDHSAVGQEMCCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL*
89 >lcl|XP_003360397.1|Plus1413122..414864 NW_003536795 e3 ubiquitin-protein ligase Praja-1 isoform 2 PJA1 __SEG__ ChrX {Sus scrofa} MHRSAPSQTTKRSRSPFSTTRRSWDDSESSGTSLNVDNEDYSRYPPREYRASGSRRGMAYGHVDCFGADDSEEEGAGPVERVPVRGKTGKFKDDKLYDPEKGARSLAGVP
PRFSSFNRDVRDELDKLDPAPAARRSANRAEFLQPNSMTSQPPSAEGKVVTNGNSLERERREQNLPVRPSRAPVSICGGGENTPKSAEEPVVRPKIRNLASPNCVKPKIF
FDTDDDDDMPHSTSRWRETASAEEGHSDGLARRGRGESSSGYPEPKYPEDKREARNDQVKPEKVPRRRRTMADPDFWTYSDDYYKYFEEDSDSDKEWTAALRRKYRGREQ
NMSSSGESWETLPGKEEQDTEQARVNAGAGASPSAGASAGSSGSSELEEVRGPSVQEEEQASPEEGEVPWLQYNENETSSEGDNDSGQEFLQPGVFMLDGNNNLEDDSSV
SEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAVDVEVANPPASKESIDALPEILVTEDHSAVGQEMCCPICCSEYVKGEVATELPC
HHYFHKPCVSIWLQKSGTCPVCRCMFPPPL*
90 >lcl|XP_003360402.1|Plus1complement(398522..399091) NW_001886637 ubiquitin-conjugating enzyme E2 E1-like LOC100626899 __SEG__ ChrX {Sus scrofa} MSDDDWRASTSSSSSSSSNQQTEKEANTSKKKESKVRMSKNSKILSTSAKSIQKELTDITLDPPPNCSAGPKGDNIYEWRSTILGPGSVYKGGVFFLDITFTPAYPLKPP
KVTFQTRIYHCNINSQEVICFEKLKDNWSPALTISKVLLSVCSLLIDYSPAEPLVGSIATQYMTNRAEHGRMAGQWTKR*