SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor O    

ID / Description / Sequence
1 >lcl|NP_001002818.1|Plus1complement(809205..810248) NW_047597 FK506-binding protein-like Fkbpl __SEG__ Chr20 {Rattus norvegicus} METSLISPMKENNTAQPQQREENTQQNLNAAVPIKQQSPGLLPEALEVGVKPDPASQILATQEIENPVAGFEGDSDKFHISTDEMAEHLQASDLWYCPDGSFVKKIIVHG
HGLDKPKLGSKCRVLALGFPFGSGMPEGWTELTIGTGQWREKTWGELTEKCLESMRQGEEAKIHLPGSSTPLAKLRLDSFTNGRDSWELEAVEKEALAKEEHRRGTELFR
AGNPQGAARCYGRALRLLLTLPPPGPPERTILHANLAACQLLLGHPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGDLDKATADLKKVLAVDPKNRAAKEELGKVVIQ
GKIQDAGLARGLRKMFS*
2 >lcl|NP_001002833.1|Plus1complement(17841047..17842474) NW_047696 Sumo1/sentrin/SMT3 specific peptidase 17 Senp17 __SEG__ Chr4 {Rattus norvegicus} MWQPKQPGVGMKPEASEQRRKRKHLDQSGTETESEALGQGPSWNCQGGTQMVFQKPGKARKKTRQEHQDQKLKKEQPGKGQGQKTQEEGSGNIKPLECQPDQTVVEKLAE
GGKCRKRQYSVLQEKPQSPQNEKHARSLEHLQGGHPVRSDPHRPHPTFSDTSNNKGGMPGHPHGRETAHGDRQPSTEVLSTKREKRCAEEKCVRGNSLEHGLRGTENANI
LDSGGGRLLPDKVAVVAGEKNALPEQENNQEKEFTKEMEKEVEKALGPGAQEEILSTGFKLKITRGDMQTLKNGQWPNDEIINFYMNLLVQRNENQGYPALHAFSTFFYA
KLKHGGYNSVKRWTRGINLFEKELILVPIHQRVHWSLVVIDLRKRSIVYLDSMGQTGKNICETIFHYLQNESKTRRNMELDPVEWKQYSLTSQEIPQQLNGSDCGMFTCK
YADYISRDQPVTFSQQHMPLFRRRMVWEILHSHLL*
3 >lcl|NP_001002834.1|Plus1complement(17776732..17778159) NW_047696 Sumo1/sentrin/SMT3 specific peptidase 18 Senp18 __SEG__ Chr4 {Rattus norvegicus} MWQPKQPGVGMKPEASEQRRKRKHLDQNGTETESEALGPEPSRNCQDGAQMVFQKPGKARKKTHQEHQDQKLNKEQPGKGQGQKTQDEGSGNIKPLEGLPDQAVVEKSTE
GGKCRKRPYSVLQEKPQSPQNEKHARSLEHLQGGHPVRSDPHRPHPTFSDTSNNKGGMPGHPHGRETAHGDRQPSTEVLSTKREKRCAEEKCVRGNSLEHGLPGTANANI
LDSGGGRLLPDKVAVVAGEKNALPEQENNQEKEFTKEMEKEVEKALGPGAQEEILSTGFKLKITRGDMQTLKNGQWLNDEVINFYMNLLVQRNENPGYPALHAFSTFFYA
KLKHGGYNSVKRWTRGINLFEKELILVPIHQRVHWSLVVIDLRKRSIVYLDSMGQTGKNICETIFHYLQNESKTRRNMELDPVEWKQYSLTSQEIPQQLNGSDCGMFTCK
YADYISRDQPVTFSQQHMPLFRKRMVWEILHSHLL*
4 >lcl|NP_001004445.1|Plus13821840..3822853 NW_047762 zinc finger protein 183 (RING finger, C3HC4 type) Rnf113a2 __SEG__ Chr6 {Rattus norvegicus} MAEQVSQGKSADQVCTFLFKKPGRKGGAGRRKRPACDPDSGESGSSSDEGCTVVRPEKKRAAHNPMIQKTSGSGKQKGAYCDLSSEEEEKAGNESLGVVYKSTRSAKPVG
PEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKFMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFL
HDRSDYKHGWQIERELDEGRYGVYEDENYEVESDDEEIPFKCFICRQTFQNPVVTKCKHYFCETCALQHFRTTPRCYVCEQQTHGVFNPAKELIAKLEKYRKAEGGTSNT
SEDPDGI*
5 >lcl|NP_001011913.1|Plus1complement(9715354..9717387) NW_047430 fidgetin-like 1 Fignl1 __SEG__ Chr14 {Rattus norvegicus} METSSSRSVQVDDWQKNYSVVASSICTPKQKADAYRALLLHIQDAYANSEISQVFATNLFKRYTEKYSAIIDSDNVVTGLNNYAESIFALAGSQQADSDKWQSGLSINNV
FKMSTVQEMMQAGQKFKESLLEPADASVVMCKEPTIFEVPQLGVCGGSEEADLLSSSVHGTEKTQAIPGNSLRCSPFQSTLFPMATNTKTCLTSSAPSGESTTATFHRTP
LFGNTKKEPQSFPKTSTGLNMFLSNPSCVPSGCENPRERKAFNDSDTINMLSNPTLNKAPSKTEDSGQREDNSLPTFKTAKEQLWADQKKRSHQSQHTSKSFNGAIKKSL
GAGRSRGIFGKFVPPVSNKQDGSEQNGNVKPKSSRAGSAEPAHLTDDRLKNVEPRMVELIMNEIMDHGPPVHWEDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGI
LLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNR
PQEIDEAARRRLVKRLYIPLPEASARKQIVVNLMSKEQCCLTDEETELVVQQSDGFSGADMTQLCREASLGPIRSLHTADIATISPDQVRPIAYIDFENAFRTVRPSVSP
KDLELYENWNKTFGCGK*
6 >lcl|NP_001011956.1|Plus1complement(49330638..49332698) NW_047657 leucine carboxyl methyltransferase 2 Lcmt2 __SEG__ Chr3 {Rattus norvegicus} MGPRSRQRRTGTVQSTNDSSSLSKRSLAAQGYVSDAFAPLLVPGIVRRTPLIHRGYYVRARAVRHCVRAFLDLTGAIRSPTRAQILSLGSGSDSLYFRLKAAGLLTRTAV
WEVDFPDVSRLKAKRIEETPELCAQTGPFKIGDSASTLCFESSDYRILGADLRELQRLGEALDSAGLDATSPTLILAEAVLTYLEPSRAAALIAWVAQRFPNALFVIYEQ
MKPGDAFGQIMLQHFRRLNSPLHGLELFPDVEAQRQRFLQAGWTTCSALDLNEFYRRLIPADERRRVETLEPFDEFEEWHLKCSHYFILAASRGDILSETPVFLPSEASF
QIDPALPSGFLSASVVTSDHQHSSLQRYGHTSVLLSPGIIFSAGGFGEQEGRHCRVSRFHLLSRSCDSEWKGCQISTLGTEGQWDGRLYHTMTRLSDTRVLVLGGRLSPV
NPASGALQLDIYKSEDNCPEGQNVVVTKAALEEGSMLSCWRHSTTEVYYQNQRYLFVYGGRSVTDPVLSDCRFLHVETMAWVRIPVQGSSPEGRHSHSACSWQGGALIAG
GLGASEEPLSSVFFLRPVSSGFLWESIHIQPSITPRYSHTAHVFNGKLLLVGGVWIHSSSVPGVTVISLTTGLSSEYQIDTASVPWPLMLHNHSSALLPEEQQLLLIGGG
GNCFSFGTYFNPHTVGLDLSSLGLGQ*
7 >lcl|NP_001012103.1|Plus11590148..1592115 NW_047714 tripartite motif-containing 32 Trim32 __SEG__ Chr5 {Rattus norvegicus} MAAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRACGRRLPR
QFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELTGELQRRKAALEGVSRDLQARYKAVLQEYGHEERRVQEELARSRKFFTGSLAEVEKSNSQ
VVEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRTVNMEDSWAVEEGAASSASASVTFREMDMS
PEEVVPSPRASPAKQRSSEAASSIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQSEVLVADRGNYRIQVFNRKGFLKEIRRSPSGIDSFVLSFLGADLPNLTPLSVAMNC
HGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGAGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNVENRQNEHHLEG
GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCVKIYSYHLRRYSTP*
8 >lcl|NP_001012210.1|Plus112612869..12614092 NW_047454 ret finger protein 2 Trim13 __SEG__ Chr15 {Rattus norvegicus} MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGLLEGNVRNSLWRPSPFKCPTCRKETSATGVNSLQVNYSLKGIVEKYNKIKISPKMPVCKEHLGQPLNIFCVTDM
QLICGVCATRGSHTKHVFSSIEDAYTQERDAFEFLFQSFETWRRGDALSRLDTLETNKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQTYDPEIN
KLNSILQEQRMAFNIAEAFKDVSEPIIFLQQMQEFREKIKVIKETPLPPSNLPTSPLMKNFDTSQWEDIKLVDVDKLSLPQDTGVLTSRSPWHPCLLLMAVVLLGLLVFF
GPTVFLEWSPLEELATWKDCLSSFNSYLTKSADFVEQSVFYWEQMTDGLFVFSERVKNVSLVALNNVAEFVCKYKLL*
9 >lcl|NP_001012488.1|Plus1complement(6347345..6349693) NW_047762 polyglutamine-containing protein Pqcp __SEG__ Chr6 {Rattus norvegicus} MSAAQVSSSRRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRAHGCFQDGRSPGPPPPVGVKTVALSAKEAAAAAAAAQQQQQQQQQQQQQQQ
QPQQLNHVDGSTKPAVLPAPSGLERYGLSAAAAAAAAAAAAVEQRSRFEYPPPPVSLGSSSHAARLPNGLGGPNGFPKPAPEEGPPELNRQSPNSSSAATSVASRRGTHS
GLVTGLPNPGGGGGPQLTVPPNLLPQTLLNGPASAAVLPPPHGLGGSRGPPTPAPPGAPGGPACLGGPPGVSATVSSAPSSTSSTVAEVGVGAAGKRPGSVSSTDQEREL
KEKQRNAEALAELSESLRNRAEEWANKPKMVRDTLLTLAGCTPYEVRFKKDHSLLGRVFAFDAVSKPGMDYELKLFIEYPTGSGNVYSSASGVAKQMYQDCMKDFGRGLS
SGFKYLEYEKKHGSGDWRLLGDLLPEAVRFFKEGVPGADMLPQPYLDASCPMLPTALVSLSRAPSAPPGTGALPPAAPTGRGAAASLRKRKASPEPPDSAESALKLGEEQ
QRQQWMANQSEALKLTMSAGGFAAPGHAAGGPPPPPPPLGPHSNRTTPPESAPQNGPSPMAALMSVADTLGTAHSPKDGSSVHSTTASARRNSSSPVSPASVPGQRRLAS
RNGDLNLQVAPPPPSAHPGMDQVHPQNIPDSPMANSGPLCCTICHERLEDTHFVQCPSVPSHKFCFPCSRESIKAQGATGEVYCPSGEKCPLVGSNVPWAFMQGEIATIL
AGDVKVKKERDP*
10 >lcl|NP_001013921.1|Plus1complement(4594671..4596509) NW_047562 ubiquilin-like Ubqlnl __SEG__ Chr1 {Rattus norvegicus} MPHIISRSPRMPQSRHPAGVPADGNIPPGVIRVIVKTPGNQNVFTVAEDTSVRQFKEQLSSHFKCQMEQLVLVSMGRLLKDHDTLSQRGITDGHTIHVVIKSKHGSRSLT
HSFRNLLTNNPCHQDRNPKGNSSTVCQSAGMSETKVESSILMEPDASKVCTQDPEVGSPEQIEQMLETLCVQRLLSNMFFMHQLPPEHPDMQDLIQQNPEVSHLLDNSEI
LCQTLELARHLAIIQEIMQIQQPAQNPEHTLNPQPYLGLETIPNGNIVLGQGYDNFNDHMLNGVHVHDLLEDDSFTALLAEQVLEQVQTPSLCQPPPQEQWGQLSSSQVI
FANSCGFLTTPTEANLNTTNNASRENPAIAATQGQSNVCAVQQPTEIPSLCTIPVIQEPREGDKDTTIPQGSSAQWLEEDLQQSEEQSSSQITRSMIQLLRTHPHMAAEM
LLLLNPPQLNEQWRQQTATPLQSSQLSDLLLALANPKTSQALLQIEHGLQLLATEAPALLPYIEPYLWGLGWLIPSSCDYLDTVPWTWNVQDTVEPQCPESCHKSGTVLQ
REQPLSGDSSHSLQAPEVRFSKEMECLQAMGFVNYNANLQALIATDGDTNAAIHKLKASQGF*
11 >lcl|NP_001013963.1|Plus1complement(5237591..5238334) NW_047756 hypothetical protein LOC298795 LOC298795 __SEG__ Chr6 {Rattus norvegicus} MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSFEERNLLSVAYKNVVGGQRSAWRVLSSIEQKINEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKG
AGEAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANRPEEAISLAKTTFDEAMADLHTLSEDSYKDSALIM
QLLRDNLTLWTAENAGERVARLQRSPRA
12 >lcl|NP_001014146.1|Plus1complement(31584561..31585712) NW_047354 DnaJ (Hsp40) homolog, subfamily C, member 28 Dnajc28 __SEG__ Chr11 {Rattus norvegicus} MVNTVCAKMARILRLHLTNASLIPPGVKLLSDPGSRMISTHKPKELSEYYRLLNLNEGCSADNIREAFHRLAKQYHPDSGSADADSATFIKIEEAYRNVLSHVIKQMQAR
QNKAEDAEEEAEKFKYNTPQHRHYLSFEGVGFGTPSQREKQYRQFRADRATEQVMEYQRQKLQREYFANSITVKDVWQSKQQKITQAMDRLVEDLIQESMAKGDFDNLSG
KGKPLKKFSGCSYIDPMTHNLNRILIDNGYQPEWILMQKEIKDTIEQLREGLLVSRKKLGSPLSPVGQKQWTHVCEQFQEDIRKLNKRISDFNLIVPILTRQKVHFDAQK
EITRVQEIYRAFIEAKEVAEDKQTDISQGEEEKTPSIKAGFLNWLNLWKFIKI*
13 >lcl|NP_001014791.1|Plus1complement(99795..100820) NW_048033 ring finger protein 113A1 Rnf113a1 __SEG__ ChrX {Rattus norvegicus} MAEQLSPGNSTGKVCTFLFKKPGRKGTAGRRKRPLCDEGSGDSGSSSDEGSAVVRPEKKQATHNPMIQKTRGSAKQKTNYGGLSSEDENEPEGLGVTYKSTRSAKPVGPE
DMGATAVYELDTEKERDAQSIFERSQKIQEELRGKEDDKIYRGINNYQKYVKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHD
RSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEEIPFKCFICRQTFQNPVVTKCRHYFCESCALQHFRTTSRCYVCDQQTNGVFNPAKELIAKLGKHRAEAEGAASDFL
EDPEESPVSII*
14 >lcl|NP_001020224.2|Plus113136078..13137814 NW_047774 polypeptide N-acetylgalactosaminyltransferase 4 Galnt4 __SEG__ Chr7 {Rattus norvegicus} MAVRWTWAGKSCLLLALLTLAYILVEFSVSTLYASSGADRARELGPRRLSDHETREEDLSQPLYKKPPADSHALGEWGRASKLQLDEGELKQQEELIERYAINIYLSDRI
SLHRHIEDKRMYECKAKKFHYRSLPTTSVIIAFYNEAWSTLLRTIHSVLETSPAVLLKEIILVDDLSDRIYLKAQLEAYISNLDRVRLIRTNKREGLVRARLIGATFATG
DVLTFLDCHCECNTGWLEPLLERISRDETAIVCPVIDTIDWNTFEFYMQTGEPMIGGFDWRLTFQWHSVPKHERDRRTSRIDPIRSPTMAGGLFAVSKKYFQYLGTYDTG
MEVWGGENLELSFRVWQCGGKLEIHPCSHVGHVFPKRAPYARPNFLQNTARAAEVWMDDYKEHFYNRNPPARKETYGDISERKLLRERLQCKSFDWYLKNVFSNLHVPED
RPGWHGAIRSMGISSECLDYNAPDNNPTGANLSLFGCHGQGGNQFFEYTSNKEIRFNSVTELCAEVPQQKDYVGMQNCPKDGLPIPVNIIWHFKEDGTIFHPHTRLCLSA
YRTADGRPSVQMKTCDALDKNQIWRFEK*
15 >lcl|NP_001037743.1|Plus1complement(20504298..20505443) NW_047689 E3 ubiquitin-protein ligase RNF133 LOC681395 __SEG__ Chr4 {Rattus norvegicus} MNPLQTGPWQTSAPSFWLLKFSFIWLVSQNCCTASAVWTAYMNISFHVGNRMLSELGETGVFGRSSILKRVAGVVVPPEGKIQNACDPNTSFILPRNKEPWIALIERGGC
AFTQKIKVASENGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNVKGMEILHLIRKGVHVTVMVEVGRKHVIWLNHYFVSFMIVTTATLAYFTFYHIRRLWVARIED
RRWKRLTRELKKAFGQLQVRILKEGDEEVSPNADSCVICFEAYKPNEIVRILTCKHFFHKNCIDPWILAHGTCPMCKCDILKALGIQMDIEDGSDSLQVLMSNELPGTFS
AMEEELNNELPPARTSSKVTHVQEHPTSVNVGSQPPEAEETGHPSFGQHDL*
16 >lcl|NP_001071146.1|Plus1complement(4571835..4573367) NW_047562 hypothetical protein LOC499222 RGD1562433 __SEG__ Chr1 {Rattus norvegicus} MARAREEAGDSQLVSGRESSSRIIRVSVKTPQDCQEFFLAENSNVHRFKKQISKYLHCDTDRLVLIYTGKILQDQDILSQRGILDGSTVHAVVRSRLKGSACTGTLAGPT
GHCTHRSEPSVKLGRLARSSPDLADFFSQLVQLLPAAPESVVQFLEDPLIQGLANEKQANGVHIPESSKTVQKRDPALKFPETFQKPVQQQEVLQEHKQRLEALKAVPGG
DNAMHPSCSDIQQAMLSTLASLVASKGHISGSDLCRGEANNAHSSLDTTTIPATSAPVRTLAQEVSTGGVTQVKGLVSSQAGSGCRQGMLDLHPSSETPSQESQQPVEKV
PLTNQLRLSPSVLRRALTVLQQNPSLAHQLATGSPLLHHIPLLPILTNPRALQALLQIEEGLMILSREVPELGPLFRESAKPRGARGAQETRGRRQAHREDTSQHSLAFL
QLFHSLASACSQSTQTALPASPFTEDRYQQELEELKALGFANHDANLQALVATDGDIHAAIEKLLGAPQD*
17 >lcl|NP_001099502.1|Plus14564470..4565375 NW_047454 proteasome beta 11 subunit Psmb11 __SEG__ Chr15 {Rattus norvegicus} MALQDVCKWQAPDTHGLSLRLPQAGGWAVPRGCDPQTFLQIYGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASRKVIPVHRHLLGTTSGTSADCATWYRVLRR
ELRLRELREGQLPSVAGTAKLLSAMMSRYRGLDLCVATALCGWDHSGPALFYVYSDGTCLQGDVFSVGSGSPYAYGVLDRSYHYDMTVQEAYTLARCAVAHATHRDAYSG
GSVDLFHVRESGWEYISRSDACVLYRELQEAQGFEQELEAKASEVLPEPATPQDARESELSVELEEVTPEDCKIIVKTETM*
18 >lcl|NP_001099526.1|Plus162077326..62078033 NW_047454 tripartite motif-containing 52 Trim52 __SEG__ Chr15 {Rattus norvegicus} MAAPTGPPSPMQSLREEAVCAICLDYFKDPVSIGCGHNFCRGCVTQLWGKEDEQDREPPAVGNHVIREVLFHRYTEQEVFQHRAHAGRWAAHSHRRHRGNADSVWDDEEE
DWNSLQGLVHDLRIRVFPEERDEHPHDGHQYHHYGRYRHRPVFRRGPPHPPVRRQLYPDARPRSPPRVRSPPRVHSPPRVRSPPRPTSQVFSCPQCRRTFPSRSFRPNLQ
LANMVHIIRQICHTP*
19 >lcl|NP_001099775.1|Plus1complement(11313846..11314457) NW_047390 ring finger protein 152 Rnf152 __SEG__ Chr13 {Rattus norvegicus} METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKLPPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKER
TLLPGDMGCRLLPGSQQKSLTVVTIPAEQQPLQGGAPQEAVEEEPDRRGVAKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG*
20 >lcl|NP_001099936.1|Plus1complement(14159247..14160374) NW_047627 protein arginine methyltransferase 6 Prmt6 __SEG__ Chr2 {Rattus norvegicus} MSLSKKRKLESGVGGAGGEGAEEENGGEQEAAPPRPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
VEASAIWQQAQEVVRLNGLEDRVHILPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPDSAELFVAPISDQMLEWRLGFWSQVKQHYGVDMS
CMESFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYGSAPLHGFAIWFQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEPVP
VEQDTDISGEITLLPSRDNPRRLRVLLRYKVGDHEEKTKDFAMED*
21 >lcl|NP_001100418.1|Plus1complement(902910..905393) NW_048049 ubiquitin specific peptidase 26 Usp26 __SEG__ ChrX {Rattus norvegicus} MDPVLIHAQVQLWSAKAGMSKSRNAFIETFIGKREVKLILYFSTGKIKALQLYNNIKSVVLRTYGEDQNYLHLTFKNNDFLFVEKLTTMDARRLKRFLDKIYQSNLRAAR
RSGERPGDPSTSAQELSSSPPEGHLKASSACFESAKESEMCLFRQLPLLPPSSASLNAVGLLESQFMKRKRFFLGAEKEKQNLKGSTREFETNLVVSISNEKGKERGVRA
VEISKAGFGFPFETNYPEEGSVNVRDLNDLITKLFSPLLFETHYIENGLDWHEYMETFLLDPEKSWQGLPNVGNTCYINVVLQSLCSIPLFVNDLFNQGFPWIKPPKDDF
NMRLMQLLVLKDIYNARTRQKLLIGITKALPIFGEVFAADRQNDAHEFLSLCLVQLKETVQRVNMMWQSENESGDYYLLREIFANYTSINRTPVCPVTNNFEFELLSSIF
CKACGLTVFKREPSRYLSINIPQGMKDQNMSIQSSLDLFFRAEELEHRCERCLYNKSVALHKFGRLPRVIIVHLKRYSFSESRIMNKDEQHIVISKYLRLSCHCNKNTKP
PQPLLPNEHVKNLDLLRPLEELGSEILKLSSNSGRTSRSKVFPTVNIRSDKELEVQNGKRVSEVSSGSAQQEDPGKGANVVRSELTNETETIKHEKEYVLSDLDSGSISE
ERSQKCQEAEKCNKEALPQSCPKPSSQEQTENLGKPAVSHTQNGSLSSQGSSDSSKSPGCNDVFDKAKPTSKVEPQKLNQKEDNIYRLVSIINHIGNSPNGGHYINDAFD
FRKQSWFTYSDLQVTGIQEDLVYKARLSTGYVFFYMHNDIFEELLAKEAWSTSTSKG*
22 >lcl|NP_001100890.1|Plus12878487..2879653 NW_047535 RNA binding motif protein, X chromosome retrogene-like Rbmxrtl __SEG__ Chr19 {Rattus norvegicus} MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEILLMKDRETNKSRGFAFVTFESPADAKDVARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLR
GGSGGTRGPPSRGGYMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSTPSGPVRSSSGMGGRTPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSR
DYPSSRDTRDYAPPPRDYTYRDYSHSSSRDDYPSRGYGDRDGYGRDREYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSD
LYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY*
23 >lcl|NP_001100953.1|Plus11776334..1778088 NW_047556 interferon regulatory factor 2 binding protein 1 Irf2bp1 __SEG__ Chr1 {Rattus norvegicus} MASVQASRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHVLPEGRSPGPPALKHPTSKDLASTGSQGSQLPPPQAQAQPSGTGGSVSGPD
RYDRATSSSRLALPSPALEYTLGSRLANGLGREEAVAEGARRALLGSIPSLMPPGLLAAAVSGLGGRALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAE
EWHGRPKAVREQLLALSACAPFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTEYPCGSGNVYAGVLAVARQMFHDALREPGKALASSGFKYLEYERRHGSGEWRQL
GELLTDGVRSFREPAPAEALPQQYPEPAPAALCGPPPRAPSRNLAPTPRRRKASPEPEGETAGKMTTEEQQQRHWVAPGGPYSTETPGVPSPIAALKNVAEALGHSPKDP
GGGGGSVRAGGASPAASSTTQPPTQHRLVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGD
KCPLVGSSVPWAFMQGEIATILAGDIKVKKERDP*
24 >lcl|NP_001101013.1|Plus1complement(4584211..4586178) NW_047562 ubiquilin 3 Ubqln3 __SEG__ Chr1 {Rattus norvegicus} MAKSGEALPQGSPAPVQDSQLIRVTVKTPKDKEDFSVVDTCTIRQLKEKISHRFKAHPNQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTTGTECPAPPVSTP
GPNPLELPQPNSAYPVDGSPSFSLGVLTGLSGLGLTSGSFSDQPGSLMWQHMSVPELVAQLVDDPFIQGLLSNTGLMRQLVLDNPHMQQLIQQNPEIGHILNNPEIMRQT
MEFLRNPSMMQEMMRSQDRALSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFATATTASTTTTSSQPSRTENCDPLPNPWTSTCGVSGSRQGRQPGDQDTSESR
NRLPSFLGNIGLFDYLQQLHETSQALGSYLQGTVPTPSSSQETPLSGNRVPPNLPPSPKPGSGQPLPKDSVAIKGKSSCPAFLRHSSENSTGQGGSLHDSGKSSTGPSTG
LPNLTSQIGDNANRSPFVSTPSSLISPTPGAPESPWLPPTGYPRSLRSALTNQVPRMQNELHQQLPLLLHLQTAMTNPRVMQALLQIEQGLQILATEAPRLLLWFMPCLA
GLSGVIGGTESREGVVMSEDPRPTPTSQISLVQGSAELGFHSSPFLQVLQALASTNPQQLQLEAHFRVQLEQLRAMGFLNLEANLQALIATGGDVDAAVEKLRKS*
25 >lcl|NP_001101553.1|Plus17409377..7410822 NW_047774 ubiquitin thiolesterase 44 Usp44 __SEG__ Chr7 {Rattus norvegicus} MDRCKHIEQLQLAQGHSILNPQKWFCMVCNTTESIWACLSCSHVACGQYIQEHALKHFEESSHPVAFEVNDMYVFCYLCNDYVLNDNTAGDLKSLRSTLSAIKGKSYPCV
VQSDSVLQPVNAQADSYSLHDSTQSLPGSEDPMCTALWHRRRALMGKTFRTWFEQSPIGRKRQEQTQEKTVAKREVKRRQQELEQQMKAELECTPPRKSLRLQGLSEAAT
VEILPVQAPPPPPASPAKEKALALPPSEDGKLKRVSDSLIKRRPAVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCFLKLDLNQWLAVAASDKARSYKHSAVTDAATA
AAHQLNEGQEKEKGFACSRHPGLSSGLSGGASKGRNMELIQPREPSSPYSSLCHELHTLFQVMWSGEWALVSPFAMLHSVWKLIPAFRGYAQQDAQEFLCELLDKIQREL
ETTGTKLPALIPTSQRRLIEQVLNVVNNIFHGQLLSQVWIS*
26 >lcl|NP_001101670.1|Plus1complement(9295048..9296070) NW_047813 tubulin folding cofactor C Tbcc __SEG__ Chr9 {Rattus norvegicus} MEGVDCSVALADAAAGSPRDLSLVPERLQRREQERQMEVERRKQKRQDQEVEEEKSGFFAAAFARERAAAEELLQGEASAERLEEAANRLQALRKLLNDSVLFLAAYDLR
QGQAALAQLQSVLTERRQELQPKKRFAFKARKKDAAGTAQVDAAPVTSAAPSPPLTEEEGAPGASWACGFSNLESQDLEKRAEELHQRDILLSDLTNCTVRLRGNPNTLR
LAKARGCKVLCGPVTTSVFLEDCRDCILAVACQQLRVHTTKDTRIFLQVTSRAIVEDCSGIQFAPYTWSYPGIDKDFQDSGLDRSKNNWNQVDDFNWLAQNVPSPNWSIL
PEEDRDIQWD*
27 >lcl|NP_001101721.1|Plus1complement(457971..459887) NW_048038 ubiquilin 2 Ubqln2 __SEG__ ChrX {Rattus norvegicus} MAENGESSGPPRPSRGPAAAPGAANPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQG
QATTQPSTTAGTSTTTTTTTTAAAPPAATTSSAPRCSTTATTTNSSNLGLGSLASLGNLGLNSSNFTELQNQMQQQLLASPEMMIQIMENPFVQSMLSNPDLMRQLIMAN
PQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFATVGSSSSSGEGTQPSRTENRDPLPN
PWAPPPTTQTSATTTTTTTSSGTVAGSNTSSTTAGNTMAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDMAAQMMLSSPLFTANPQLQEQM
RPQLPNFLQQMQSPETIAAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGVGVGVLGTAITPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPASSPGSTGTGIPPAT
TVSSSAPTETISPTSESGPSQQFIQQMVQALTGGSPPQPPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS*
28 >lcl|NP_001101722.1|Plus11006485..1008575 NW_048038 hypothetical protein LOC317398 RGD1562211 __SEG__ ChrX {Rattus norvegicus} MAHVREASRSSRSVACWSSGGGRGACLEQAAENASRMEQTMRGTQGAQEMKPELWPEPKPTSENLTSRGSGSDEKVLPSIPAACHTSSSSVCPRRKPRPRPQPRSRSRGG
RGLKAPPPPPAKPPPPPPAPPPPPLPKPRPVAWRNSRRRPRPAPRPQTRKSYPSDPGCSGDSDGTENRLLEVGFDKGPTGCSHVEIFKVAKNWRRNLRMIYQRFIWSGTP
ETRKRKAKTCICRVCSTHKNRLHSCLSCVFFGCFTEKHIHIHAETKQHNLAVDLYHGVIYCFMCKDYVYDKDIEKIAKETKEKILGLLMSTAGDMSYQQLMASEVEENQS
ICESKEQETSLVKPKKKRRKKTVYYTVGLRGLINLGNTCFMNCIVQALTRIPLLKEFFLSDKHKCMMTSPSLCLVCEMSSLFQAMYSGNQSPHIPYKLLHLIWIHAEHLA
GYRQQDAHEFLIAILDVLHRHSRDDGIEQEGNLNHCNCIIDYIFTGGLQSDVTCQVCHGVSTTIDPCWDISLDLPVSYTPGRAGSTGQKPRVISLTDCLKWFTRPEDLGS
SAKIKCSRCQSYQQSTKQLTMKKLPIVACFHLKRFEHLGKQRRKINTFISFPLELDMTPFLASTKESIMKGQPLTECVPIENKYSLFAVINHHGTLESGHYTSFVRQEKD
QWFSCDDAVVTKATMEELLYSEGYLLFYHRQDIEKE*
29 >lcl|NP_001101725.1|Plus13565775..3566518 NW_048040 hypothetical protein LOC317486 RGD1565844 __SEG__ ChrX {Rattus norvegicus} MAEEESASTSYTEDDFYCPICQEVFKTPVRVAACQHVFCRKCFLTAMKESRIHCPLCRGNVTRRERACPERALDLETIMRSFPGNCRCCSQRVELYRMRQHYKTCEKYQD
EFGVATPASSFQLSPDSVGNSNNEASASENAEAFQEEEDNVSPPDQPTFDCPLCEEVNMTRQRLLDHCNSSHRGHVVPVICPICLSLPWGDPTQLTRNFVSHLNQRHQFD
YGDFVNLQLDEETQYQIAIEESFHVNI*
30 >lcl|NP_001101935.1|Plus1complement(10594677..10597295) NW_047555 ubiquitin specific peptidase 29 Usp29 __SEG__ Chr1 {Rattus norvegicus} MAHLKIHGLVQIRSTNRSKHTRASQWKEAVIEIVERKQKVNLVVSFKLEERRRVFQLGDNVTGVVVSGELGLYHLDLTLRDDTSLLIDKLSSADVEHLKSFLDSSTPCES
QQPMESMSNQDTLEISDPFFRENQDVVCVSLNTALESGTLLSRKMPLCMSNTTGSHTEKKRGEKQGRKRKTEPSPSTVEVTTKDILKENNPEQKKKSRRYYSRNRGGKAE
KAVALREQEKRNNWKLEPAFSSKVYGKSTLDGTVLPIATCSDDRDLSIFGLEIITHNGIQPPPDNYLKQLKREGFPNLGNTCYMNSILQSVFGIPTFAKDLLTQGIPWEK
VSYDDLIMPLSQLLVLKDIRDIEIKGELLTSVKKSISTVADTFSGNEQNDAHEFLSLCLDQLKLNMEKVNAMWDTERKNEPTCAGAKRFVCPVGANFEFELHSSIICEGC
GEATLKTEVSNYLSIDLHHGTKTHPLSIQKSFDLFFTPEKIEHNCEKCKNKNSVLKYTLRRLPRVLIVHLKRYQVTTDLLPVKSEQPVEISQYLNISSHCHENRKLPFPL
INTPPKGDYDIPNVSPGLMPEIFSQSMSSKKVISESSDPLVLQVGSSVDAEIQSFQIMYEDESEEEQQRGLESGSMLDPELLKTENRVFRQKISPAPDSMMGDGYSFLPM
LCEPMSIQDPGLAEMGLQEVPENPEFKYYGKPDGRTNSELSKLHQNHGGRIKGSYLPASFANMRSSLEDPEKDLSRSSEFEEDDPHSFALGSDESKDEEMGDNLHNYRLV
SVVSHFGSSPNSGHYVSDVYDFQRQAWLLYSDVQVFENPDPSSQENRLHTGYIFFYMHNEIFEELLKKASECKVLSTSKEEKRDIDYFSTLLNGLTYILEEF*
31 >lcl|NP_001102298.1|Plus142476388..42477023 NW_047334 ring finger protein 222 Rnf222 __SEG__ Chr10 {Rattus norvegicus} MSEGESKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTIVCPICRYVTFLSKKSSRWPSMLDKSSQTLAVPVGLPSTPSPDRGGHTNPLV
ISHQVWRQSPSQGTQLPLDLLPSLPRESQIFIISRHGMPLGEQDSVLPRRSLAEISEASPAPSATRSFCCRSRALLLITLIAVVAVVAAILPWVLLVRKQT*
32 >lcl|NP_001102305.1|Plus12440965..2441576 NW_047339 heat shock protein, alpha-crystallin-related, B9 Hspb9 __SEG__ Chr10 {Rattus norvegicus} MGTVGGPFLFAPAPRMWGGGGGSPRALRQQLHSRMQRVGSSFSTGQREPGENRVASRCPSVALSERNQAATLPVRLLKDDLAAAHANGCEEPSFQMKLDAHGFAPEDLVV
RIDGQNLMVTGKRQQESNDPSRGRYRLEQSVHRQMQLPMTLDPAAMTCSLTPSGHLWFKGQNKCLPLPEAQTGPQTGQALRFKRGSSKCPNPP*
33 >lcl|NP_001102401.1|Plus11051693..1052157 NW_047600 hypothetical protein LOC365554 RGD1560350 __SEG__ Chr20 {Rattus norvegicus} MLLRIAFKAINQGGLTSVAVRGKGRAVIVTQKRAPVKLLDSSTVTHLFKMTESIGCVVTGVTADGRSQVQRAHYEAGNWKYKYGYDISVDMPCKRIADTSQVYTQNAEMR
PLGCWMILIGIMKNKALRCTTVIPQATTCGFKATAPGVRQSQLP*
34 >lcl|NP_001102415.1|Plus1complement(45374806..45376017) NW_047625 tripartite motif-containing 59 Trim59 __SEG__ Chr2 {Rattus norvegicus} MHNFEDELTCPICYSIFDDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCRSIIEIASTGIESLPVNFALRAIIEKYQQEDHPDVVTCPEHYRQPLNVYCL
LDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLFKQLTDTHWTDITRLIEKLEEQKCHSEKIVQSDKEVVLQYFKELTDTLEQKKKFFLAALCDVGKMINQEYTP
QIERMKEIREQQLELMTMTTSLQDESPLKFLEKIDDVRQRVQMLKQRPLPEVQPVEIYPRVSNVLKEEWSRTEIGRIKKAVIPEMRISSKRMPCSWPDKDEKEMECFKIL
NIAIVSLISVILMLILLFNHHIITFLNEITSICFSEVFLSVYQSLSKNLYDLKNTVCYTLYLLKEFMWKIVSC*
35 >lcl|NP_001102494.1|Plus1complement(14819..15478) NW_047371 DnaJ (Hsp40) homolog, subfamily C, member 30 Dnajc30 __SEG__ Chr12 {Rattus norvegicus} MAAARCLAWPLSSLRRLWQVQGLPQSSATGLCSRVRTYSRNALYDLLGVPSTATQAQIKAAYYRQSFLYHPDRNPGSTEAAERFTRISEAYLVLGSTILRRKYDRGLLSD
QDLRGPGVKPSKTPVADPTPPRPPPYTPRAHGGSRASQGDGRTMFDFDAFYQAHYGEQLERERRLRARREALRKKQKDHASKGPRWDDTRDATFFVILFLIFIFVGFRI*
36 >lcl|NP_001102587.1|Plus1complement(1170722..1171465) NW_047491 ring finger protein 182 Rnf182 __SEG__ Chr17 {Rattus norvegicus} MASQPPEEPAEFQVSDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGSKGKKCLPENPTELLL
TPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVP
SSLVILMVYGFCQCVCHEFLDCMALPS*
37 >lcl|NP_001102665.1|Plus13408855..3409652 NW_047651 ring finger protein 208 Rnf208 __SEG__ Chr3 {Rattus norvegicus} MPADPGPEVGSGWPGLLMSCLKGPHVILKMEAMKIVHPEKFPELPAATPCFPPAPRPTPTLAPKRAWPSDTEIIVNQACGGDMPTLEGASHTPPLPRRPRKGSSELGFPR
VAPVDEVIVNQYVIRPGPTASAPSSSGPVIAGEPLECPTCGHTYNVTQRRPRVLSCLHSVCEQCLQILYESCPKYKFISCPTCHRETVLFTDYGLAALAVNTSILSRLPP
EALTAPSGGQWGGESEGSCYQTFRQYCGAACTCHVRNPLSACSIM*
38 >lcl|NP_001102718.1|Plus116082861..16083553 NW_047694 DnaJ (Hsp40) homolog, subfamily B, member 8 Dnajb8 __SEG__ Chr4 {Rattus norvegicus} MANYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDRAGCDGWRAGGGASVPHAGPFGAGYPFRNPEDIFREFFGGLDPF
SFEFWDTPFSDRGRPHGLRGAFSSGFGEFPAFMEAFSSFDTLGHGGGSHSTFSSTSFGGSGSGSSGFKSVMSSTEMVNGRKVTTKRIVENGHERVEVEEDGKLRSVTVNG
KEKLMRVDSK*
39 >lcl|NP_001102747.1|Plus1complement(569024..571267) NW_047762 hypothetical protein LOC500688 LOC500688 __SEG__ Chr6 {Rattus norvegicus} MAPFLRPSTWNRVLLSATLWLSVFGSLLSPVCCSHGPPKWRFSTSEVVIPRKVPQRMGKSDMSGHITYSMRFRGQRHVVHMKLKKNMISQNFPVYTSNDQGAQQEDYPFV
PQDCYFYSYLEGVPGSQATLDTCTGGLKGMIRVDDSTYEIKPLTSSSKFEHVISLLVVDERSRKSKKCRNDEIMAEAGDSLVKETKLAGSPRAAPVYLWRIHVKSIAIMY
TVTHQVFLDGGSNITQSLELTMTLNTIADSIYRPSGLIVFIRALCLWNDGDHFPTGDGNIWRLMERYGYWKARFFWEMHHATAALLISNIRSNAEYAGFQDGVCNPNWGV
LYTHVGKNHYFLAASFLAHAVGHILNVGHDKPGCVCFRRSSCTMHEYPTLHDMMSNCSHNVLHYRIHDWDGCLSQPRVSYRWINYAVPRCGNKIVDNGEKCDCGSFKDCA
SDHCCGTTCELTASSVCASGGCCQSCKFAPIGTVCRQKGGICDLPEYCSGKSEHCPGNFHIMDGTPCSPLAVCVSGNCSDRQLQCQALFGFNVKDASPACYKELNTKGDR
FGNCGIREVRGGSKPMRCQEEDVLCGQIHCDGVKFIPGGGEHTTFHHIKVMDIKEEQCFGYDAHHGAQVPEMGLVVDGATCGPGKYCRGQRCVFHQTMGFNCNVSKCNYK
GVCNNQGNCHCVQGWQPPDCIEKGAGGSVNSGPAVIYEKRIRAKVHMSINRLIILLGTRMFLIFASIISGAISKAVLRPVGDQYPPY*
40 >lcl|NP_001102801.1|Plus17860661..7860939 NW_047626 dolichyl-phosphate mannosyltransferase polypeptide 3 Dpm3 __SEG__ Chr2 {Rattus norvegicus} MTKLTQWLWGLALLGSAWAALTMGALGLELPLPCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQILEARADLARKGLRF*
41 >lcl|NP_001102804.1|Plus118152558..18153550 NW_047555 hypothetical protein LOC502300 RGD1561909 __SEG__ Chr1 {Rattus norvegicus} MPCPRLPWLRRHRTSQGSSPGSPSTLSAPNFPSRGEDEDAEEEEGDGTPGSGPILPPASPMECLICVSPFDGIFKLPKRLDCGHVFCLECLARLSLATAGGGDAVACPMC
RAPTRLAPRRGLPALPTQPGLLPCDARAPLPRQGSVRFDRRRGLLYLRPPPPSPGPRKSRTVRAPPPPPPLRLGRPLSRRLSLSSPAWAFNAAVALAVLVAAGLVVSGVY
IFFLIPHVTTSSPARPQIVALAPENGFWVSPRPTPVAPWTHTWTRRPTKPDLDDTLTETTKDTPELEATKGPVEIQETPDLSPDQTPNAETDLSWDRKAWTDGKRVQLQQ
*
42 >lcl|NP_001102866.1|Plus1complement(3195518..3196243) NW_047817 DnaJ (Hsp40) homolog, subfamily B, member 3 Dnajb3 __SEG__ Chr9 {Rattus norvegicus} MVDYYEVLGVPRQASAEAIRKAYRKLALKWHPDKNPEHKEEAERRFKQVAQAYEVLSDARKREVYDRCGEVGEVGGGGAAGSPFHDAFQYVFSFRDPAEVFREFFGGHDP
FSFDFFGDPLENFFGDRRSTRGSRSRGSVPFSTSFTEFPGFGGGFASLDTGFTSFGSPGNSGLSSFSMSCGGGAAGNYKSVSTSTEIINGKKITTKRIVENGQERVEVEE
DGELKSLIINGKEQLLRIDTQ*
43 >lcl|NP_001102929.1|Plus115410998..15411417 NW_047689 hypothetical protein LOC685171 LOC685171 __SEG__ Chr4 {Rattus norvegicus} MLTPEWKKAATVLRDVKVRAVDAGRHQSLGDQYGVQGFPTIKIFGASKTKPEYYQGGRTREATVDVALSALHQLLKDCLGRHSSVYCSGKQVKGDSSCKKDMVELTDDTF
DYNVLVVKTLVWLDFMFHGVDINLEPEWW*
44 >lcl|NP_001103062.1|Plus11753269..1754114 NW_047726 ring finger protein 186 Rnf186 __SEG__ Chr5 {Rattus norvegicus} MPDIRCQQVPAESRKEAGSVPTGPEPMQVPAAPADIACGCPCAEQPHPPSSVPRVSCTEAPQPIPAGATTTNTIIALGPTGRLSISVEGDLECLVCREPYNCARSPKLLS
CQHTFCAVCLKLLLYVQEDTWSIPCPLCRKVTAVPGGLICSLRDQEAMVGRLALPCPEVRLCPQRLVGPAASAAAHPANRTGEDEQDVVSVNRVAARRLAVHLLLLALLI
VLILPFIYPGVIRWVLAFVIALALLMSTLFCCHPQSQSSNWPCPRTLFCREQKQTQITSIA*
45 >lcl|NP_001103070.1|Plus11242971..1245151 NW_047627 ADAM metallopeptidase domain 30 Adam30 __SEG__ Chr2 {Rattus norvegicus} MRSVWASLPQHRWLLLAMLFLEAMAEDLLFDPDWGFDSYEITIPKVLSLRKEAQGVDSSLSYLLQIEGKERVVHLRPKKLLLPRHLPVFSFTQEDSLIEDYPHIPDQCNY
VGFVEGSQEAESTLSTCMGGLRGVLNIDSRYYQIEPLRASSRFEHVVYLLTEDNFGNETCGVVDEETDGQTAEEEEVARIKNFHQSYKHQRYLELVMVFDLSRYVFTRGN
MTRMVEDAILLASIADTYFQDVSLKIQLKALEVWTQFDKIHLYYSSLSQVLGQFVLYKRASLHHRLPADWAHLYIARRYSDATAWSWGRACEEFHAGSASSFLNVNLLGP
ATWTAHEMGHCVGMYHDEEFCQCRGRKSCVMGTGRTGFSNCSYHQYFLHASYKMSYCLSDFPKLHIVERCGNKIVENKEECDCGSEEECKSDLCCGPDCKWKEGVNCSSG
LCCHKCNFLPSGYVCREEENECDLAEYCDGLSGFCPKDYYKQDGTPCRYGGFCFHKGCRSRYLQCQAIFGRRAKEAPRQCYDAVNMIGDQSGNCGIVNATRYTKCHRDNT
ICGRLQCVNIKALSRFPDHTLLLSTHLKKDNLKCWGTSYHGTMIPHGVPDIGDVNDGTSCGPNRVCLNRTCVDYATLKFDCLPKKCNSRGVCNNKKNCHCTYGWEPPFCV
EVGYGGSIDSGPPGPRARLAKVHVLYMLRTILFIFSVIVVCFTQRMKNLFRKRQQKNPAETQGKKR*
46 >lcl|NP_001107220.1|Plus1complement(16713058..16714332) NW_047799 ring finger protein 26 Rnf26 __SEG__ Chr8 {Rattus norvegicus} MEAVYLVVNGVGLMLDLLTLVLDLNFLLVSSLLATLAWLLAFIYNLPHTVLTSLLHLGRGFLLYLVALVEAVVRFTFGGLQALCTLLCSCYSGLESLKLLGHLASHGALK
SRELLNRGILNMISNGHGLLRQACDICAIAMSLVAYVVNSLVNICLIGTQNFFSLVLALWDAVTGPLWRMTDVVAGFLAHISSSAVAMAILLWTPCQLVLELLASAVRVL
ASCVLFHLTGLVLLACVLVVILIALHPEQTLRLATRALNQLHARPSYHRLREDVVRLSRLPLGLEAWRRVWSRSLQLASWPNRGGAPGAPQGGPRRVFSARIQPQDPLPE
ADEEVIRTAAARGRERLNEEEPTAGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRSILQTLNVYL*
47 >lcl|NP_001121017.1|Plus112724896..12726737 NW_047779 ring finger protein 139 Rnf139 __SEG__ Chr7 {Rattus norvegicus} FSFSLGIVVSSIVLILSQRSLFKFYMYSSAFLLAATSVLVNYYAALHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIGYVTLLHIQSIYSQLIILNILVPVIG
LITELPLHIRETLVFMSSLILIFNTMLVLAVKLKWFYYSTRYVYLLVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRITAQATVLMYILRMANETESFLISWDDFWD
IICNLIISGCDSTLTVLGMSAVISSIAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLIRLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSS
FHRHFPVLFVSACLFILPVLLSYVLWHHYALNTWLFAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYFVRSTGNIIEFIFGVVMFGNGAYTMMFESGSKI
RACMMCLHAYFNIYLQVKNGWKTFMNRRTAVKKINSLPEIKGSHLQEIDDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNN
GFIAPNENQNPEEALREDAAGSDREMNEDDSTDCDDDIQRERNGGIQHTGAAAAAAEFNDDTD*
48 >lcl|NP_001123982.1|Plus1complement(186280..187191) NW_047781 DnaJ (Hsp40) homolog, subfamily B, member 7 Dnajb7 __SEG__ Chr7 {Rattus norvegicus} MVDYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNGEKRDIYDKYGKEGLTGGGGSHLDDEREYGFTFRKADDVFKEIFGERDPFSF
HFFEDSLADLLSSSRSSSGSRSRGSLFSRSYDYPVFARLSSYDTGYSPYVSRGHESLTSVSSLAFEDPGVGNYIPITPSVINGRNVKTKKTFENRQERKVEDDSELRSFL
VNEEGFADKCNWRRQSFNDYSPNSYTHSSTTQYSLVDDKEQGTPWVTNKKEPSIFSAGFKEGGRRKKKKHKEGQKKKSNKRNR*
49 >lcl|NP_001129469.1|Plus1complement(9390825..9391943) NW_048034 ubiquitin-conjugating enzyme E2Q family member 2-like Ube2q2l __SEG__ ChrX {Rattus norvegicus} MSSGLKAELEFLASIFDKDHERLRIVSWQLDELQCQFLVPPAPAGSPPLPPPLTLHCTITESYPSSPPIWFVDSDDPDLTSILERLEDSKPNSSLRQQLKWLICELCSLY
NLPEHLDVKMLDQPVPIAQKATIEEVPSEDEEEDAADGLEDLDHYELKEDTCSEKKSEDEGLEKEHLAILENIKKSQRQEHLNGTVSGSVHASNRLMKELREIYRSQSYK
SGTYSVELINDSLYDWHVKLRKVDPDSPLYGDLQLLKEKEGIEYILLNFSFKDNFPFDPPFVRVELPILSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKG
KARVRFGADKNQYNLETAQQSYDSVVQMHEKKGWFTPPKEDG*
50 >lcl|NP_001137222.1|Plus13342278..3342622 NW_047651 Notch-regulated ankyrin repeat protein Nrarp __SEG__ Chr3 {Rattus norvegicus} MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYA
ASGR*
51 >lcl|NP_058930.1|Plus13363123..3364040 NW_047624 peroxisomal membrane protein 3 Pxmp3 __SEG__ Chr2 {Rattus norvegicus} MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFLWLFLWRFTIYSKNATVGQSVLNIQYKNDSSPNPVYQPPSKNQKLLYAVCT
IGGRWLEERCYDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKPQSMREVGFEYMNRELLWHGFAEFLVFLLPLINIQKLKAKL
SSWCIPLTSTAGSDSTLGSSGKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDMYFTCPKCGTEVHSVQPLKSGIEMSEVNAL*
52 >lcl|NP_064481.1|Plus16792257..6793642 NW_047565 interferon-induced protein with tetratricopeptide repeats 1 Ifit1 __SEG__ Chr1 {Rattus norvegicus} ENADGDQVMENLLQLRCHFTWGLLFEKNDIPDLEVRISEQVQFLDIKNSLGMHNLQAYVRHLKGEQEEALQSLKEAEALIEGEQLGKRSLVTWGNCAWVHYHRGSLAEAQ
IYLDKVENVCREFSSPFHYRMECAEIDCEEGWALLKCGGSNYMRAMACFAKALQVDPENPEYNAGYAVVAYRQDFDDNHVSLEPLRKAVRLNPEDPHLKVLLALKLQDLG
EQDEAETHIEEALSSTSCQSYVFRYAAKYFRRKGDINEALHLLHRALQTSPSSGYLHYQKGLCYKQQMIQLKTSGNRQARRQENIQELAHQAICEFQETLNLRPTFEMAY
VCMAEMQAEIGQYEEAEGNFQEALNLNNLVAHIEQDIHFRYGRFQQFHKKSEDKAITHYLKGLKLEEKSFAWRKLLTALEKVAERRVRQNVRLVESTSLLGLVFKLKGQE
MKALLYYEKALRLSGEMNPAF*
53 >lcl|NP_064701.1|Plus1complement(623895..626162) NW_047762 a disintegrin and metalloprotease domain 4 Adam4 __SEG__ Chr6 {Rattus norvegicus} MAPFLRPSTWTWVLLEGALWLSVLCSLLSSVCCSHGPPKWRFSTSEVVIPRKVPQRMGKSDMSGQITYSMRFRGQRHVVHMKLKKNMISQNFPVYTSNDQGAQQEDYPFV
PQDCYFYSYLEGVPGSQATLDTCTGGLKGMIRVDDSTYEIKPLTSSSKFEHVISLLVVDERSRKSKKCRNDEIMAEAGDPLEETKLAGSPRAAPVYLWRIHVKNIAIMYT
VTHALFIQVGHNQTTSLELVLIMNSIADSIYRPSGLIVFARAICIWNKQDNFNITEYSDSVIKLMEQFGYWKSTFYWDFPHATSALLSGTKYGNKDYAAFQNGLCNPNWG
VLYTHVGKNHFFLAASLMSHAVGHIFNIGHDKPGCVCFRRSSCVMSEFPTLLDMMSNCSHHNLHEKIIGWDACLSQPRVAYKNFKYAVPRCGNKVVDDNEQCDCGTLKDC
LSNHCCGTNCQLIGSSTCAEGLCCQSCRFAPTGKVCRHTNGICDLPEYCSGVSEHCPQNFYIMDGTPCSPLAVCMSGNCSDRQLQCQALFGYHVKDASPACYKELNTKGD
RFGNCGVREVRGGSKPLACQEEDIFCGQIHCDGVKFVPGGGEHTTFHHIKVMDVKEEQCFGYDAHHGTELPEMGLVLDGANCGPGKFCKAQKCVIHTELNFHCNITQCNY
KGVCNNKGNCHCVPGFQPPHCIQRGTGGSVNSGPPATFQEKLRAEIHVSINRLIIIIGTRILLILASVLFGALFRALMLETEKKKKKTQHPTINK*
54 >lcl|NP_068635.1|Plus1347900..349801 NW_047761 heat shock protein 2 Hspa2 __SEG__ Chr6 {Rattus norvegicus} MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKG
EMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIF
EVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLD
KGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSS
VLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTY
NIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGSSGGPTIEEVD*
55 >lcl|NP_075236.1|Plus1complement(10724..11125) NW_047588 caseinolytic peptidase B protein homolog Clpb __SEG__ Chr1 {Rattus norvegicus} MMLSAVLRRTAPAPRLFLGLIKSPSLQSRGGAYNRSVITGDRGEPQRLRTAAWVRPGASSVLFPGRGAATGGRRGERTEIPYLTAASSGRGPSPEETLPGQDSWNGVPNK
AGLGMWALAMALVVQCYNKNPSNK
56 >lcl|NP_112263.1|Plus1complement(2123050..2123493) NW_047419 ubiquitin-conjugating enzyme RGD69425 __SEG__ Chr14 {Rattus norvegicus} MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLL
CDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM*
57 >lcl|NP_114177.2|Plus1563857..565782 NW_047597 heat shock 70kD protein 1A Hspa1a __SEG__ Chr20 {Rattus norvegicus} MAKKTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVVNDGDKPKVQVNYKGE
NRSFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVK
ATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKLDKAQ
IHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLI
QVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRERVAAKNALESYAFNMK
SAVEDEGLKGKISEADKKKVLDKCQEVISWLDSNTLAEKEEFVHKREELERVCNPIISGLYQGAGAPGAGGFGAQAPKGGSGSGPTIEEVD*
58 >lcl|NP_620261.1|Plus133930694..33932949 NW_047762 a disintegrin and metallopeptidase domain 6 Adam6 __SEG__ Chr6 {Rattus norvegicus} MLSLTWGMKLVERSVVPRVLLLLFALWLLLLVPVRCSEGHPTWRYISSEVVIPRKEIYHSKGIQTQGRLSYSLRFRGQRHIIHLRRKTLIWPRHLLLTTQDDQGALQMDY
PFFPVDCYYFGYLEGIPQSMVTVNTCYGGLEGIMMLDDLAYEIKPLNDSQGFEHIVSQIVSEPDVTGPTNTWKRLNLNTGPPLSRTEYANGTPRMSSKNYASHPAAIKGQ
FQATNSIYKESNNIDTAARYLFELLSITDSFLITIHMRYYAILLTVFTESDPFALEYTVPGGSIYNYYVSNFFNRLRPDASTVLNKDGPSDNDFHPVEQSLCTPAGLTIV
GQHRRSFLALSVMITNRIAMSLGIKADDETYCICHRRTTCIMYKNPEITDAFSNCSLVQINQILNTPGTMSCLFYDHHVYHNITKTYRFCGNFKIDIGEQCDCGSHKACY
ADPCCGSNCKLTAGSICDKELCCANCTYSPSGTLCRPIQNICDLPEYCSGNNIFCPADTYLQDGTPCSEEGYCYKGNCTDRSVQCKEIFGVNAKGANIKCYDINKQRFRF
GHCTRAQESLMFNACSDHDKLCGRLQCTNVTNLPFLQEHVSFHQSVISGFTCFGLDEHRGTETTDAGLVKHGTPCSQTNFCDRGACNGSLSRLDYDCTPEKCNFRGVCNN
HRHCHCHLGWKPPLCREEGPSGSTDSGSPPKERRTIKQSREPLLYLRMLFGRLYLFIVSLLFGVATRAGVIKVFKFEDLQAALRAAQAKAT*
59 >lcl|NP_620267.2|Plus1complement(450606..451460) NW_047474 protein phosphatase 1 regulatory subunit 3B Ppp1r3b __SEG__ Chr16 {Rattus norvegicus} MAVDIEYSYSSMAPSLRRERFTFKISPKLNKPLRPCIQLGSKDEAGRMVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAESESFV
LDFPQPSADYLDFRNRLQTNHVCLENCVLKEKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQSY
WDSNKGKNYRITRAELRSTQGMTEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLGPYY*
60 >lcl|NP_997669.1|Plus1563857..565782 NW_047597 heat shock 70kD protein 1B Hspa1b __SEG__ Chr20 {Rattus norvegicus} MAKKTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVVNDGDKPKVQVNYKGE
NRSFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVK
ATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKLDKAQ
IHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLI
QVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRERVAAKNALESYAFNMK
SAVEDEGLKGKISEADKKKVLDKCQEVISWLDSNTLAEKEEFVHKREELERVCNPIISGLYQGAGAPGAGGFGAQAPKGGSGSGPTIEEVD*
61 >lcl|XP_001055808.1|Plus15434537..5436477 NW_047354 heat shock cognate 71 kDa protein-like isoform 1 LOC680121 __SEG__ Chr11 {Rattus norvegicus} MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNCTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGE
TKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYVLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVK
STAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ
IHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLI
QVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMK
ATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD*
62 >lcl|XP_001058360.1|Plus1complement(11705356..11706696) NW_047689 RNA binding motif protein, X-linked isoform 1 Rbmxrt __SEG__ Chr4 {Rattus norvegicus} MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEILLMKDRETNKSRGFAFVTFESPADAKDVARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLR
GGSGGTRGPPSRGGYMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSTPSGPVRSSSGMGGRMPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSR
DYLSSRDTRDYAPPPRDYTYRDYSHSSSRDDYPSRGYGDRDGYGRDREYSDHPSGGSYRDSYESYGNSCSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSD
LYSSDRDRVGRQERGLPPSMERGYPPPRDFYSSSSRGAPRGGGRGGSRSDRGGGQKQILETNKTLDQGLHAEKHKMESLCHNYQGLIREKLCYLFKFSVLSPPSFLCSCE
EKVKHD*
63 >lcl|XP_001058530.1|Plus116061948..16062331 NW_047561 ubiquitin-like protein fubi and ribosomal protein S30 LOC681191 __SEG__ Chr1 {Rattus norvegicus} MQLFVRAQELHTLEVTNQETVAQIKAHVASLEGTAPEDQVVLLTGSPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKMAKQEKKKTGRAKRRMQY
NRRFVNVVPTFGKRKGP*
64 >lcl|XP_001059623.1|Plus15225660..5227225 NW_047761 peptidylprolyl isomerase (cyclophilin)-like 2-like LOC362758 __SEG__ Chr6 {Rattus norvegicus} MGKRQHQKDKMYITCAEYIHFYGGRKPDITQTSFRRLPFDHCSLSLQPFVYPVCTPEGVVFDLLNIVPWLKKYGTNPNTGEKLDGKSLIKLNFAKNSEGQYHCPVLYSVF
TDNIHIVAIRTTGNVYTYEAVEQLNIKARNLRDLLTDEPFSRQDIITLQDPTNLDKFNVSSFFHVKNNMRTIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEI
LAATMKPPEKKKVDQLNAAHYSTGKVSASFTSTAMVPETTHEAAVIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDLTPKTCENFIKLCKKRYYDGTIFHRSIRNFVI
QGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITFRSCAYLDEKHTIFGRVVGGFDTLTEMENVESDPKTDRPKEEVHICTTTVFVDPYEE
ADAQIAQERKKTQHQVDPEAKAKKKQPQPGNQGPPTYRRGVGKYINPAATKRAAEEEPSTSTAIPTVKKRPSRGFGDFSSW*
65 >lcl|XP_001059772.2|Plus1complement(1340..>1585) NW_047384 DnaJ (Hsp40) homolog, subfamily C, member 30-like LOC680976 __SEG__ Chr12 {Rattus norvegicus} RAHGGSRASQGDGRTMFDFDAFYQAHYGEQLERERRLRARREALRKKQKDHASKGPRWDDTRDATFFVILFLIFIFVGFRI*
66 >lcl|XP_001060456.1|Plus1complement(6801188..6801604) NW_047817 tyrosine 3/tryptophan 5 -monooxygenase activation protein, theta polypeptide-like LOC681140 __SEG__ Chr9 {Rattus norvegicus} MQLSPESKVFYLKMKGDYFRCLAEVACGDDRKQTIGNPQGAYQEAFDISKKEMQLTRPIRLGLALHSPVFYYESLNNPEPAYTLAKMAFDEAIAELETLNEDSYKDSALV
TQLLRDNLTLWTSDSAGEECDAADGAEN*
67 >lcl|XP_001072887.2|Plus1complement(32906614..32907816) NW_047658 rCG37285-like Zcchc3 __SEG__ Chr3 {Rattus norvegicus} MATGSGAEEEPQRGRPELPLPARPVARAEESEGVREKMGWAQVVKNLAEKKGDFREPRRRDEAGSGASGGLGSSGSLAAPNPGDFPPAARGDPKGRRRDPTGEAADAYRK
KGASSAGDPSRRKKADVSAAMPTPARSGATEDATERPLQDEPPAAGPGKGRFLVRICFQGDESACPTRDFVVGALILRSIGMDPDDIYAVIQIPGSREFDVSFRSAEKLA
LFLRVYEEKRELEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPK
TCFKCGSRTHMSGTCTQDRCFRCGEEGHLSPYCRKVIVCNLCGKRGHAFAQCPKAVHNSMAAQLTGLAGH*
68 >lcl|XP_001073579.1|Plus1complement(19018492..19019220) NW_047563 DnaJ (Hsp40) homolog, subfamily B, member 6-like LOC690183 __SEG__ Chr1 {Rattus norvegicus} MVDYYEVLGMQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYSKEGLNGGGGGGGSHFDSPFEFDFTFRNPDDVFREFFGGRDP
FSFDFFEDPFDDFFGNRRGPRGSRSRGAGSFFSAFSVFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSASFGGSGMGNFKSISTSTKIVNGKKITTKRTVENGQERVEVE
EDGQLKSLTINGKEHLLRLDNK*
69 >lcl|XP_001073854.1|Plus119924325..19926577 NW_047563 SUMO1/sentrin/SMT3 specific protease 3-like LOC690251 __SEG__ Chr1 {Rattus norvegicus} MKKQKKILWKKGIHLAFSEKWNTGFGGFKKLYFPQNLCFLKAKLGRPVVWHRQSKHFQCNKRGLHIQKTWAQDVPLCSKTKSGVATQNVSSLYAKVKRKDTKHFISSSRS
LLKLQADKLLSSAKNLGREYCREKSLLKAGPGLSANTVLGKANGHKPSTDPQASDFPMKFNGESQSPSDSGKTVVLNKHRKRVCYGCYQGLEHHRNRRPLIPKKFQPNQY
RRVKVSLMMYEKLSMIRFRYRIFRSQHFRTKSRVCKLRKAQQSWVQKVTGDHQENFRDNNTEGGDCSPVPSLEPKDPCRCQPYFPDMDSSAVVKGKNCHVPDGHTKESPA
LDKEHGLDAAFPDQQNGSTTYTWDQPFSSPKWECTEQIHEIPLMGHPSSDNFTPGTERALMTLGQESGTSAVSDDGVKLSVSGADESVSSVDGPVSEEPAQNKNFQMEED
GSLRQNILSLKLLDHPYCKSPLDAPLVCSELKVENQVAGGKSGQTASPVDDEQLSTCLSGFLDEVMKKYGSLVPLSEKDVLGRLKDVFNEDFSNRKPFINREITNYRARH
QKCNFRIFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDKVHFFNSFFHRQLVTKGYNGVKRWTKKVDLFKKSLLLIPIHLEVHWSLITVTLSSRIISFYDSQ
GIHFKFCVENIRKYLLTEAREKNRPEFLQGWQTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKELCECRLLD*
70 >lcl|XP_002728136.1|Plus14461357..4461851 NW_047424 TRIMCyp-like LOC100360977 __SEG__ Chr14 {Rattus norvegicus} MVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGS
QFFICTAKTEWLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCGQL*
71 >lcl|XP_002728142.1|Plus1<4470801..4471223 NW_047424 TRIMCyp-like LOC100361959 __SEG__ Chr14 {Rattus norvegicus} XXXEVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTCHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKE
GMSIVEAMERFGSRNGKTSKKITISDCGQL*
72 >lcl|XP_002728171.1|Plus1complement(10910523..10911584) NW_047430 protein arginine methyltransferase 1-like LOC100361025 __SEG__ Chr14 {Rattus norvegicus} MAAAEAANCIMEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVK
IVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHAHDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVD
VVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLD
FTIDLDFKGQLCELSCSTDYRMR*
73 >lcl|XP_002728490.1|Plus14920275..4920991 NW_047486 proteasome activator complex subunit 2-like LOC100362709 __SEG__ Chr17 {Rattus norvegicus} MAKPCGVRLSGEARKQVDAFRQNLFQEAEDFLCTFLPRKIISLSQLLQEDSLNVADLSSLRAPLDIPIPDPPPKDDEMETEQEKKEVPKCGFLPGNEKLLALLALVKPEV
WTLKEKCILVITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTAISKYFSERGDAVAKASKDTHVMDYRALVHERDEAAYGALRAMVLDLRAFYAELHHIIS
SNLEKIVNPKGEEKPSMY*
74 >lcl|XP_002728511.1|Plus1complement(9493478..9494521) NW_047491 rCG63346-like RGD1308930 __SEG__ Chr17 {Rattus norvegicus} MEASGEQLHRSEASSSTSSEDPPPAEELSVPEVLCVESGTSEVPIPDDQLQDRLLSAQKVAALPEQEELQEYRRSRVRSFSLPADPILQAAKLLQQRQQAGQPSSEGGEP
AGDCCSKCKKRVQFADSLGLSLASVKHFSEAEEPQVPPAVLSRLHSFPLRAEDLQQLGELLAVAKVPAPLLTPRAQLRPLFQLPGLIAAEERLRRQRVCLERVQCSQPPR
AEVTGSGRVISCPGPRAVAVRYTFTEWRTFLDVPAELHPESLEPLSPVRSGNSGPGAEDSEGEPGTERFCFSLCLPPGLQPKEGEDADTWGVAIHFAVCYRCEQGEYWDN
NEGANYTLRYVCSTDPL*
75 >lcl|XP_002729074.1|Plus1complement(920478..921194) NW_047624 proteasome subunit beta type 6-like LOC100360846 __SEG__ Chr2 {Rattus norvegicus} MAAALAVRGAISAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVH
TAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAIQQSGVERQ
VLLGDQIPKVTISTLPPP*
76 >lcl|XP_002729147.1|Plus19618884..9619483 NW_047627 peroxiredoxin-1-like LOC100363379 __SEG__ Chr2 {Rattus norvegicus} MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPREIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKR
TIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK*
77 >lcl|XP_002729475.1|Plus117960100..17961527 NW_047696 Sumo1/sentrin/SMT3 specific peptidase 18-like LOC100362532 __SEG__ Chr4 {Rattus norvegicus} MWQPKHPGVGMKPEASGQHRKQKHLDQNGTETESEALGQGPSRNCQDGAQMVFQKPGKAQKKTRQEHQDQKLKKEQPGKGQGQKIQDEGSGNIKPLEGLPDQAVVEKSAE
GGKCRKRPYSVLQEKPQSPQNEKHARSLEHLQGGHPVRSDPHRPHPTFSDTSNNKGGMPGHPHGSETAQGDGQSSTEVLSTKREKRCAEEKCVRGNSLEHGLRGTENANI
LDSGGGRLLPDKVAVVAGEKNALPEQENNQEKEFTKEMEKEVEKALGPGAQEEILSMGFKLKITRGDMQTLKNGQWLNDEVINFYMNLLVQRNENPGYPALHAFSTFFYA
KLKHSGYNSVKRWTRGINLFEKELILVPIHQRVHWSLVVIDLRKRSIVYLDSMGQTGKNICETIFHYLQNESKTRRNMELDPVEWKQYSLTSQEIPQQLNGSDCGMFTCK
YADYISRDQPVTFSQQHMPLFRKRMVWEILHSHLL*
78 >lcl|XP_002729504.1|Plus113548091..13548378 NW_047710 SMT3 supressor of mif two 3 homolog 2 isoform 1 LOC682787 __SEG__ Chr5 {Rattus norvegicus} MADEKPKEGVKTENNDHINLKAVGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFEFDGQPINETDTPAQLEMEDEDTIDVFRQQTGGVY*
79 >lcl|XP_002729580.1|Plus1complement(6364577..6365356) NW_047719 heat shock protein 1, alpha-like LOC100362895 __SEG__ Chr5 {Rattus norvegicus} MVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKV
EKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIK
LGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSRMEEVD*
80 >lcl|XP_002729675.1|Plus133467867..33468268 NW_047760 ubiquitin-like protein fubi and ribosomal protein S30-like LOC100360647 __SEG__ Chr6 {Rattus norvegicus} MQLFVRAQELHTLEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRM
QYNRRFVNVVPTFGKKKGPNANS*
81 >lcl|XP_002729699.1|Plus1complement(5481933..5483498) NW_047761 peptidylprolyl isomerase (cyclophilin)-like 2-like LOC100361537 __SEG__ Chr6 {Rattus norvegicus} MGKRQHQKDKMYITCAEYIHFYGGRKPDITQTSFRRLPFDHCSLSLQPFVYPVCTPEGVVFDLLNIVPWLKKYGTNPSTGEKLDGKSLIKLNFAKNSEGQYHCPVLYSVF
TDNIHIVAIRTTGNVYTYEAVEQLNIKAKNLRDLLTDEPFSRQDIITLQDPTNLDKFNVSSFFHVKNNMRTIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEI
LAATMKPPEKKKVDQLNAAHYSTGKVSASFTSTAMVPETTHEAAVIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDLTPRTCENFIKLCKKQYYDGTIFHRSIRNFVI
QGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITFRSCAYLDKKHTIFGRVVGGFDTLTEMENVESDPKTDRPKEEVHICTTTVFVDPYEE
ADAQIAQERKKTQHQVDPEAKAKKKQPQPGNQGPPTYCRGVGKYINPAATKRAAEEEPSTSTAIPTVKKRPSRGFGDFSSW*
82 >lcl|XP_002730228.1|Plus1complement(3721262..3721642) NW_048033 rCG53187-like RGD1559949 __SEG__ ChrX {Rattus norvegicus} MASLAVASIEHPFGTFEEKLGKKSQKWDEMNILETYHPANKDYGLMKKSKPNTLYRNTVADYDDSDNDSEVNEIMNPDFLTKKLAVDEASEPTNVILEQESSGEKDDEEL
EKKQQFDMKRKLHYNE*
83 >lcl|XP_002730234.1|Plus17066601..7067149 NW_048034 protein phosphatase 1, regulatory subunit 2-like LOC100362389 __SEG__ ChrX {Rattus norvegicus} MATSTTSHRPIKGILKNKSSTSSVEDSSQSSGRPGTQELQRKKSQKWDESNILATHYPSYKDYDLMKKNEPGNPYGSMSHDGEDTINEVQGKDAMTPDNLAKKLAASDTL
GTSYQGEEQESSSAHSSKFFLDKQERQRQFELKRKLHYNEGLNIKLARQLISEELQSEVEEDENQPRLHSNY*
84 >lcl|XP_002730237.1|Plus19384341..9384526 NW_048034 rCG42933-like RGD1564569 __SEG__ ChrX {Rattus norvegicus} MLDQTQMVHTCVCTAKSECLDGKRGVWGKREGMSFVDAMQQFGHWNCKTRKKIAISKRKQL*
85 >lcl|XP_215842.2|Plus1complement(9337782..9338399) NW_047658 proteasome beta 3 subunit RGD1564425 __SEG__ Chr3 {Rattus norvegicus} MSIMSYNGGAITATKGKNCVAIAADRHFRIQAQMVTTDFQKIFPMGYRLYIDLAGLGTDVQTVAQHLKFRLNLYELKEGQQIKPYTLLSMVANLLYEKRFGPYYTEPVIA
GLDPKTFKPFICSLDLIGCSMVTNDFVVSGTCSEQMYGMCESLWEPNVDLEHLFETISQAMLNAVDQDAMSSMGVIVHIIEKDKITTRKLKAQMD*
86 >lcl|XP_233177.1|Plus1complement(3980418..3980726) NW_047716 heat shock 10kDa protein 1-like RGD1561150 __SEG__ Chr5 {Rattus norvegicus} MAGQVFRKSRLLPDRVLAERSVVVTVAKGGIMLPETTQGKVLQATIVVVGSGMKEKSEEIQPVSVKVGDKVLLLEYGGTKAVLDDKDYFLFRDGDILRKYVN*
87 >lcl|XP_234351.1|Plus14856273..4857184 NW_047761 DnaJ (Hsp40) homolog, subfamily C, member 17-like RGD1565752 __SEG__ Chr6 {Rattus norvegicus} MALTKEFLQMDLYTLLGIEEKATDKEVKKAYRQKALSCHPDKNPDNLRAAELFHQLSQALEVLTDAAARTAYDKERKARKRAAERTQRLDENRKKLKLDLEARERQAQAQ
GTEEEEESRSTTTLEQKIARLQEEGSRQLEEQQRLIQEQTRQDRKQRLRGRAENREGKRTPKLKLKWTCKKEDKSQGGYSRDVLLKLLHKYGEVLNLVVSGRKPGNAIVE
FATVRAAELAVRNEVGLTDNPLKVSWLEGQPQGTVDPSPPGLTKGSVSSERDYEGLVMMRMRQAAERQQLMAQMQQEDEGPPR*
88 >lcl|XP_341364.2|Plus1complement(52536295..52536882) NW_047454 TRIMCyp-like RGD1559682 __SEG__ Chr15 {Rattus norvegicus} MVNLTMFFNITADGEPLGRVSLELFADKVPRTAENFRSLTTGEKGFGYKGSSFHRIIPGFMCQGGKVTCHNGTGGKSIYGEKFENDSFILKHTGPGILSMANAGPNTNGS
QFFICTAKTERLDGKCVVFGKGRGGTNIVEAMEHFGSRNGKTSKKITISDCGQLLVSLICGHFTHQTIPSVAQESAPTPSARNTL*
89 >lcl|XP_345327.3|Plus1complement(3400680..3401150) NW_047651 hypothetical protein RGD1564535 __SEG__ Chr3 {Rattus norvegicus} MLQPEGLHTLEEGAALTASRNDCIICYSAYDLSVHLPRRLYCGHTFCQACMRRLDTPAHEQHWIPCPQCRQSTPMPRGGVTMLDLDLAAFLAVKAEREPSKIESRPSVPL
KVSTTITQQPAGLYPTLGPQPHFPQPRHCCRGWGRLCWYPPGNPEV*
90 >lcl|XP_346262.2|Plus1complement(244458..245444) NW_048033 hypothetical protein Ankrd58 __SEG__ ChrX {Rattus norvegicus} MAQALEDRNPLSEASDEPCESNAPSTPQIRSHSKDYGSLGRYKGQAVADSANLSRERIIPRALTVSGANGTRRRGALRELLGLQGAAPTGWLSEEHLEFAASGSRRSSGQ
GSGRVCLEPREHAWILAAAECRFEVLLEMLEVEPRLLMREDPITGYSVLHWLAKHGRHEELILLHDFARRQGLPFDVSAPGSGGLTPLHLAALQGHDMVIKVLVGALGAD
PSRRDYNGNRPCHYLRPDASLSLRELSGAEEWEIERDRELENANNNSSSSTTTTTGWLKCTSSVSRIKSVGINYKEASQSVKEKKAWGNQGGQGNGLLRQLFPFTQNR*
91 >lcl|XP_574086.3|Plus19137530..9138897 NW_047496 OTU domain containing 1 Otud1 __SEG__ Chr17 {Rattus norvegicus} MQLYSSVCTHYPAGTPGPTAAAPPATTAAFKVSLQSAGPAAAAPEPDTGERPPAAATEPREAAAAAAMPAFSACFERSGSATAAAPPGACCKPPLPPHFTSTAHIAVRAL
GAERLLLPPPSAPAPPRRGSSAWLLEELLRPDEPAAPNAARDAPDRNFRLSEHRQALAAAQHRAPAPAPVGPEPGAGPWSEERRTERSPRGWDRASGRSDASGADAHRRP
DPEIEVHPVPAPAPAPARSSGDPTQNGEGEAVGAPRADPRDEKLALYLAEVERQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSP
LIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMVHYLGPEDSLRPSIWLSWLSNGHYDAVFDHSYPNPEYDNWCKQTQMQRKRDEELAKSM
AISLSKMYIEQNACS*
92 >lcl|XP_575838.3|Plus1complement(16384144..16384716) NW_047713 rCG55211-like Rnf183 __SEG__ Chr5 {Rattus norvegicus} MSEPQVQELKAECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLSLVSPARRRLLCPLCRQTTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFL
RQPRVYTLDLGPEPGSQTGLPQDTAPDTRPVPIPSHYSLRECVRNPHFRIFAYLMAVILSVTLLLIFSIFWTKQLFWGMG*
93 >lcl|XP_576630.1|Plus1360761..361873 NW_047820 peptidylprolyl isomerase D RGD1560149 __SEG__ Chr9 {Rattus norvegicus} MSHPSPAAKPSNSKNPRVFFDVDIGGERVGGIVLELFADIVPKTAENFRALCTGEKGTGLTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHY
KHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARMLENVEVNGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADIDLKDVDKIL
LISEDLKNIGNTFFKSQNWEMAIKKYAKVLRYLDSSRAVIEKADVSRLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALEMDPSNTKALYRKAQGWQGLKEYDQALADL
KKAQEIAPGDKAIQAELLKVKQMIKAQKDKEKAVYAKMFA*
94 >lcl|XP_577126.1|Plus1complement(1577796..1578362) NW_047339 keratin associated protein 4-16-like RGD1566146 __SEG__ Chr10 {Rattus norvegicus} MVNSCCGSVCSEQGCDQSPCQESCCQPSCCQTTCCRTTCCRPSCCVSSCCRPSCQTTCCRPVCCQTTCRPSCGVSSCCRPVCCQTTCRPSCGVSSCCRPVCCQTTCCQSS
CCRPVCCQTTCRPSCGVSSCCRPVCCQTTCRPSCGVSSCCRPVCCQTTCRPSCGVSSCCRPVCCQTTCCRTTSCGPSC*