SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom O    

ID / Description / Sequence
1 >lcl|XP_001362119.1|Plus1294233..294454 NW_001581905 ubiquitin-like protein 5-like LOC100009728 __SEG__ Chr3 {Monodelphis domestica} MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTHWSKIVLKKWYTIFKDHISLGDYEIHDGMNLELYYQ*
2 >lcl|XP_001362225.1|Plus11012961..1014280 NW_001582020 UBX domain-containing protein 6-like LOC100009977 __SEG__ Chr8 {Monodelphis domestica} MKKFFQEIKADIKFKSAGPGQKLTDTAGEKGSKERQSQQASKQPRQDPTNEAQMAAAAALARLEQKQPRSRGPTSQDSIRNQVKKELQAEVTVSGISESSGANVIPEAKE
EGSANLSVTGVYFTCPFTGAILRKDQRDAHIKEVINEYADKDPVTASIMKIHTFNRDREKVKSGVDTIAKYLDNIHLHPEEEKYRKIKLQNKVFQERINCLERANEFFRA
IGFEKTSLPVPEQEALEEFYVLGEDAQVEKLEQHKVALQNSEPVRAQLARQRRIFKPSPLAAQFDLPGDFFNLTTEELKREQKLRTDPVERLSVLRTKAMREKEEQREMR
KYTYTLLQVRFPDGHILQGTFYARERLSALYSYVREALQSDWLPFELIPVGGHKLLDNSLAFNECGLVPSALLTFTWDAAVMDDIKASGAEQPPGALKPELLATVESLS*
3 >lcl|XP_001362950.1|Plus111060950..11062884 NW_001581868 heat shock 70 kDa protein 6-like LOC100011711 __SEG__ Chr2 {Monodelphis domestica} MSAPKGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLVGDAAKNQVAMNPQNTVFDAKRLIGRKFSDGVVQADMKHWPFQVVSEAGKPQVRVSYK
GESKAFYPEEISSMVLSKMKETAEAYLGQPVSSAVITVPAYFNDAQRQATKDAGAIAGLHVLRIINEPTAAAIAYGLDRAGSSRERNVLIFDLGGGTFDVSILTIDGGVF
EVKATAGDTHLGGEDFDNRLVNHFVEEFKRKFRKDISQNKRALRRLRTACERAKRTLSSSSQASLEIDSLYEGTDFYTSITRARFEELCSDLFRGTLEPVQKALGDAKMD
KSQIHDVVLVGGSTRIPKVQKLLQDFFDGKELNKSINPDEAVAYGAAVQAAVLTGDSSHKVQDLLLLDVTPLSLGLETAGGVMTPLIQRNSTIPTRQTQTFTTYSDNQPG
VLIQVYEGERAMTRDNNLLGTFELGGIPPAPRGVPRVEVAFDIDANGILNVSATDKSTGKANRITITNDKGRLSKEQVQRMLQEAEKYKAEDEAQRDRVAAKNALEAYAF
QVKSSVQEESLQDKIKEEDRRRVLDKCQEVLSWLDANQLAGKDEYEHRRKELERLCHPIMAQLYQAPPSQGGSSCGAQARHASSTSGPTIEEVD*
4 >lcl|XP_001363007.1|Plus1complement(922092..923204) NW_001581879 tubulin-specific chaperone C-like LOC100010161 __SEG__ Chr2 {Monodelphis domestica} MEASDGAASAASTASAVPVDTPAANGDMGRPRRGLGLVPERLQKREQERLLEVERRKQERQNQTVEEEKSDFFAAAFAREREAVERLLGCADQEAPGPGADPAKLDEAAS
RLQALQKLLNDAVLYLAPYDLRLGQEALARLQGALAERRQELQPKKRFAFKSRRKDPAASAPSPATSAPPPEKPPQLQQPPPQPTPPLLGGVLVPSVSGFSNRESETLQM
QAKELHQRDILLTGLTDCTIRLYGNPNTLRLTKARGCTVLCGPVSTSVFLEDCIGCVLAVACQQLRTHTTRDTRIFLQVTSRAIVEDCSGVQFAPYSWSYPGIDQDFEGS
GLDRNKNNWRDVDDFNWLARGVASPNWSILPEEERIIQWD*
5 >lcl|XP_001363008.2|Plus1complement(454706..455491) NW_001581880 lys-63-specific deubiquitinase BRCC36-like LOC100010162 __SEG__ Chr2 {Monodelphis domestica} MAVVAVHLDSDAFLVCLNHALSTEKEEVMGLCIGEVDTSKIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPVRVVGWYHSHPHITVWPSHVDVRTQA
MYQMMDQGFVGLIFSCFIEDKNTKTGRLLYTCFQSVQAQKSTDYERIEIPIHVVPHDTIGKVCLESAIELPKILCQEEQDAYRRIHSLPHLDSVTMIHNGSVFTKNLCSQ
MSAISGPLLQWLEDRLEQNQQRVRELQREKERLLQELAALD*
6 >lcl|XP_001363032.1|Plus111462460..11463218 NW_001581868 proteasome activator complex subunit 3-like LOC100012061 __SEG__ Chr2 {Monodelphis domestica} MASPLKVEQDVQGKVESFRARIAQEAEDLVSTFFPQKLSELDSRVQELRLQDLSRIRSVPAPEPPVAQDTPDTAGDGPNREPPTPATLQPAPPGKGAGLSGGEGQLLRSN
QHLVELIERVKPEIELLREKCNTVRMWVQLLIPKVEDGNNFGVSIQEDTVDQLWTVESTAASYLRRFSTYYNTRAKLVSKIVKYPQVEDYRRTVAEVDENEYLSVRQILL
HVRNQYATLHDVILKNIEKIKTPRSANTENLY*
7 >lcl|XP_001363579.1|Plus12344504..2345913 NW_001581842 probable E3 ubiquitin-protein ligase TRIML1-like LOC100010460 __SEG__ Chr1 {Monodelphis domestica} MDKRDLVENLKANLTCFICLGYFTDPVTVNCGHSFCKVCLLRCREEADSTFNCPECRGIIKDRDVVRDRNLQSLSITGKRLRSHLLQSLVDLYVCDQHGEKGKFFCEEDQ
RFLCDSCLLAPGHKDHTVLPLDMASDKCKDKIKHTLNTLQRKKEEFKVVLNKVTRKEELCVKGIHSLKQSVILEYRKLCEFLWEEEQLYLQRLDQRYTDDLAKLKLNKAK
LSQQIQNLERVKLELEENLDKGPLEMLQNMKGTLERNEELLLQEPENVSFAWCTSPITGMREMLMSFQRDISLDPESANPHLILSEDLKCVKYGDVPQDLPDNQERFDDT
LAVLGTQTFTSGKHYWEVKIGDKTELAVGVCKDSIRKKGKLTSLSKDVWTLVSFRIGNFCFLWNSQDGFFLSQPLEKVGIFLDYNKRHVAFYDVIDRSLIFSFSDMAFEG
PLRPYFSLCYSKGESNPGSIMLINMKDSQ*
8 >lcl|XP_001363605.1|Plus110938537..10938995 NW_001581842 ubiquitin-conjugating enzyme E2 N-like LOC100011673 __SEG__ Chr1 {Monodelphis domestica} MARLPHRIVKEIQGLLAESVPGIKAEPDEVNARHFHVVIAGPQDSPFEGGTFKLELFLPEEYPMTAPKVRFITKIYHPNVDKLGRICLDILKDKWSPALQILTVLLSIQA
LLSAPNPDDPLANDVAEQWKNNEAKAIETAREWTRLYATNNI*
9 >lcl|XP_001363784.1|Plus14573514..4574284 NW_001581931 14-3-3 protein sigma-like LOC100012611 __SEG__ Chr4 {Monodelphis domestica} MERGSLIQKAKLAEQAERYEDMAEFMKGAVEKGDELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKGADEEAASAEDKERGPEVREYREKVETELRAVCGTVLNLLDS
HLIRDAGDAESRVFYLKMKGDYFRYLAEVATGDDKKRTIDSARAAYQEAMDISKKEMLPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKD
STLIMQLLRDNLTLWTADCAGEEGGEAPPPEEQPQS*
10 >lcl|XP_001363880.1|Plus112468603..12469457 NW_001581965 protein phosphatase 1 regulatory subunit 3B-like LOC100013167 __SEG__ Chr5 {Monodelphis domestica} MAVDIEYRYGCVASPLLRDRFPCKISPKASKPLRPCIQLSGRSEASGVVALPVQEKKAKKRVSFADGRGLALTTVKVYSEFDDPLDIPFDITALLENIVTLTTAECESFV
LDFEQPSADYARFRRRLQAERVCLENCVLKDKALSGTVKVQNLAFEKRVKVRITFDTWKSFADVECQYVKDTYAGSDRDTFSFCIGLPDKVQPYERMEFAVCYECSGRTY
WDSNQGRNYRIVQAELQGCQGGGPAPGGADLGISFDHFGSPRCSYGLYPEWPSYLGYERLGPYY*
11 >lcl|XP_001363884.2|Plus129330346..29331326 NW_001581970 heparan sulfate glucosamine 3-O-sulfotransferase 1-like LOC100012960 __SEG__ Chr5 {Monodelphis domestica} MQSSEARPVSTMTALVLGAVLLILQPQIVPSHPVSSPKVEVPSEAGQKELFRKGSLKSDFQDSPPLNGSSQRLPQTIIIGVRKGGTRALLEMLSLHPGIAAAESEVHYFD
WEDHYGNGLEWYLSQMPFSFPHQLTVEKTPAYFTSSKVPERVYNMNQSIRLLLILRDPSERVLSDYTQVFYNHVQKHKPYPSIEEFLIKDGELNVEYKAINRSLYYFHMQ
NWLRYFPLNHIHIVDGDQLIRDPFPEIEKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH*
12 >lcl|XP_001364025.1|Plus14154093..4154749 NW_001581876 RING finger protein 222-like LOC100013083 __SEG__ Chr2 {Monodelphis domestica} MSEGESKDSVGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSCKVDGQIQKSIVCPICRYVTFLSKKSSRWPSLSSEKSSQTLTVPVGLDNLPSLDALGHTNPL
TIPHPLWVPSQSQTRVLNQSPQLPRDLLPNLVREPQIFIISRHGMPLGEEDSVLPRQSLADLSETSPAPSSSCSRCCRSRMLLLITFITVVAVIATILPWVLLVRKEA*
13 >lcl|XP_001364607.1|Plus11546223..1546795 NW_001581840 RING finger protein 183-like LOC100010996 __SEG__ Chr1 {Monodelphis domestica} MAEKLGKEPEAECPVCWNSFNNTFRTPKLLDCRHSFCIECLAHLSLVSSSRHRLLCPLCRHPTVLASDRPVTDLPTDAAILTLLRLEPNHIILEGRHLCFKDERKSRYFL
RQPRVYTLNLGVEPESQAGPPQQGAAPPAPVPIPSHLSLRECFRNPQFRIFTYLMAVILSVALLLIFSIFWTKQFLWGTG*
14 >lcl|XP_001364612.2|Plus1complement(1006209..1006721) NW_001581976 peptidyl-prolyl cis-trans isomerase A-like LOC100011004 __SEG__ Chr6 {Monodelphis domestica} MSSEAVGNPIVFFDITVDEEPLGRITFELFANTVPRTAENFRALSTGEKGFGYKGSYFHRIIPGFMCQGGDFTNHNGTGGMSIYGDTFPDENFILKHSGPGILSMANSGP
NTNSSQFFICTDKTDWLDGKHVVFGQVKTGMNIVEIMESFGSRDGRTSRKVVISNCGQFT*
15 >lcl|XP_001364618.1|Plus17176625..7178568 NW_001581838 e3 ubiquitin-protein ligase TRIM32 TRIM32 __SEG__ Chr1 {Monodelphis domestica} MATASQMNLDALREVLECPICLESFTEDVLRPKLLHCGHTVCRHCLEKLLASSINGVRCPFCSKITRITNLSLLADNLTILKIIDTAGLNEAMALLMCRTCGRRLPRQFC
KSCGMLLCEPCRTAKHSLPKHSVLPIKEAAEERRHHFGEKLAQLREVVRELQLRKETLDRVSKDLQCRYRAVLQEYGREERRVQQELARSRKFFTGSLGEVEKANSQVVE
EQGYLLNIAEVQAVSRCDYFLAKLKQADVAILEEMADEEEPELTAKLPQELTLQDVELLKMGHIGPLQIGQAVKKPRTVNIDEPWVDEIDTTSMTIREMDVSPEDMDPSP
RSSPARQRKSEAVASIQQCHFIKKMGSKGSSPGMFNLPVSLHVTNQGEVLVADRGNFRIQVFSRKGFLKEIRRSPSGIDSFVLSFLGADLPNLTPLSVAMNCQGLIGVTD
SYDNSVKVYTLEGHCIACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRSAGVVKFNCLCGAVRPKFVTCDAEGTIYFTQGLGLNLENRQIEHHLEGGFSIGSVG
PDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYNVLIREGLICPVDIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP*
16 >lcl|XP_001364628.1|Plus1complement(3296025..3296579) NW_001581875 keratin-associated protein 9-1-like isoform 1 LOC100013470 __SEG__ Chr2 {Monodelphis domestica} MVSSCCGSTCSGLSCGSGCCAPCCCRPACCLRPACCQSTCCRTNCYRPTCIVSTCCRPSCCGSSCCQPCCRPSCCGSSCCQPCCRPSCCVTSCCQPCCRPSCCVTSCCQP
CCRPSCCQPCCRPSCCVSSCCQPCCRPTCCQSSCCRPSCCVSSCCQPCCRPTCCQTTCCRTTCCRPACCGSSCC*
17 >lcl|XP_001364706.1|Plus120018018..20019745 NW_001581902 alpha-(1,6)-fucosyltransferase-like LOC100012733 __SEG__ Chr3 {Monodelphis domestica} MRPWFGSWRWIMLILFAWGTLLFYRGGHLVGDNDHPDHYRQEISKILSKLEHLKQQNENLRRMAEFLRIPEDPMDQGPDSGRVRTLKEQFLKGKEQIENYKKKTRDVGLG
KNYEILRKIENGAKELWFFLQSELKKLKDLEGIDLQRHVDEFLFDLGHQERSIMTDLYYLSQADGAGYWREKEAKNLTELVQRRITYLQNPKNCEKAKKLVCNINKNCGY
GCQLHHVVYCFMIAYGTQRTLILESHKWHYATGGWETVFRPLSETCTNREGSTNRLWSGEINDKNIQVVDLPIVDFLHPRPPYLPLAIPEDLADRLVRIHGDPAVWWVSQ
FVKYLIRPQPWLKKKIEEATKKLGFKHPVIGVHVRRTDKVRTEAAFHSIEEYMVHVEEHFQLLECRIHVDKKRVYLATDDPSLLKQAKAKYPNYEFISNNSISWLAGLGN
RYTFNSLQGVILDIHFLSQADFLVCTFSSHVCRAAYEIMQTLHPDASAYFHSLDDIYYFGGQNAHNQIAIYPHRPRTANEIPMDPGDVISVIGNHWDGYSKGFNENQGRI
GLYPSYKVKEKIETVKYPTYPEAEK*
18 >lcl|XP_001364978.1|Plus1complement(3441696..3442250) NW_001581875 keratin-associated protein 9-1-like isoform 1 LOC100013707 __SEG__ Chr2 {Monodelphis domestica} MVSSCCGSTCSGLSCGSGCCAPCCCRPACCLRPACCQSTCCRTNCYRPTCIVSTCCRPSCCGSSCCQPCCRPSCCGSSCCQPCCRPSCCVTSCCQPCCRPSCCVTSCCQP
CCRPSCCQPCCRPSCCVSSCCQPCCRPTCCQSSCCRPSCCVSSCCQPCCRPTCCQTTCCRTTCCRPACCGSSCC*
19 >lcl|XP_001365065.1|Plus1complement(65145240..65145854) NW_001581900 e3 ubiquitin-protein ligase RNF152-like LOC100016328 __SEG__ Chr3 {Monodelphis domestica} METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDLRCPWCRGITKLPPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKER
ALLPGDIGCRLLPGNQQKSVTVVTIPTEQQPLQGALPQDAVMEEEPDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG*
20 >lcl|XP_001365432.1|Plus1complement(22635630..22636757) NW_001582020 e3 ubiquitin-protein ligase RNF133-like LOC100013307 __SEG__ Chr8 {Monodelphis domestica} MNLVKTGTWRNNAASSWLLEFTVFLLLGQNYCKASAIWTAYMNISFHVGNRMLSELGETGVFGRGSILKRVAGVVVPPEGRNQNACNPLTNFSKPKDSEMWLALIERGGC
TFTQKIKVAAEKGASGVIIYNFPGTGNQVFPMSHQGIGEIVAVMIGNLKGTEILHLIQKGVHVTVMIEVGRKHIIWMNHYFVSFVIVTTATLAYFIFYHIRRLWVARIQN
RRWQRLTTDLKKAFGQLQLRVLKEGDEETNPNGDSCVVCFEAYKPNDVVRILTCKHFFHKNCIDPWILAHGTCPMCKCDILKALGIEVDVEDGAESLQILMSNESPNTTA
PNEDSTVNDHLSVRRSDKVTHGEESSSSGNDNQSGSVAVDIHPSP*
21 >lcl|XP_001365435.2|Plus12354776..2355801 NW_001581838 zinc finger CCHC domain-containing protein 3-like LOC100011492 __SEG__ Chr1 {Monodelphis domestica} MPSPELYSPGFGQGHGECQPAAPSESEDGEGRQGDAEELGKAGGREVRKKKREEEGGRRKKTDAAGFSVLSSVRAPGGEEEKKKREEKRPGAASLVRGKGPQEDAFNGRF
ILRLRFQGEDNNCPTRDYVVGTLIIKSIGMNPRDIYAVIQIPGSKEFDVSFRSAEKFDFFLRKYQEKKGQDCWENFVLIQLTKPRLKTLFILFRNETVDTGDIVTWLKRH
CDVLTTPVKVADRFGVWTGEYKCEIELWQGEEGVDHLPGAFYLGAEKGYSWYKGQPKTCYRCGSKNHMSLTCSQEKCFRCGEQGHSTTFCKKGIVCNLCGQKGHIYANCP
SAGHSAGITGE*
22 >lcl|XP_001365544.1|Plus1complement(1908788..1910839) NW_001581929 ubiquilin-3-like LOC100020316 __SEG__ Chr4 {Monodelphis domestica} MAKSGEVPPRASPASTTDPHIIKVTVKTPKDKEEFAVQDTCTIQQLKKEISQRFKAHPDQLVLIFAGKILKDPDSLVQCGIRDGLTIHLVIKMQKRGGGPECLAPSQPAL
PPPPPPPPPPVPLHPGGAHPFSLGVLTGLNGLGLTSGSFPDLQSQLLWQHISVPELVAQIIDDPFIQGLLSNTGLVRQLVLDNPYMQQLIQHNPEIGHILNNPEIMRQTL
EFLRNPAMMQEMMRSQDRALSNLESIPGGYNALRTMYTDVMDPMLNAVQEQFGGNPFAAAATTSSATNSGCSQPSRTENCDPLPNPWATHYGITAGGQDRQHGGQDSRHI
PLRSDPQEGSPGFPSIGLTGYLQQLLEPPQGLGAYLQGPASLGLSQEPSPTTLSGGHAPPAVPPAQQSGARQSLPKEPLAVKTKTTCPAFLRPPTTSSSKRGSDKEDGSV
GPKGHSTNMPNLVSGLTATSGDGFMTSSTAPVAGPPQAPEPAWMARPTYVRPPRTVPMDTSTRGALQFQEEMQRQLPLLVHLQAAMANPRALQALLQIENGLQTLATEAP
RLLLWFSPSLGVLGIPSFMPGAEMGSCPLNNPTSVVNPEECPETVARTVSSGQGLAEVESLSDPFFQMLQVLTNTGPQLQSSPLQQPEAQFQPQLEQLHAMGFLNPEANL
QALIATEGDVDRAVEKLRESQIS*
23 >lcl|XP_001366284.1|Plus1complement(1664475..1665131) NW_001581876 histone H1.3-like LOC100012082 __SEG__ Chr2 {Monodelphis domestica} MSETAPAASAEPNATAVTAPVPPPVEKAPTKKAKKAGRPKAVGPPVSELITNAVAASTERNGVSLAALKKILAASGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGS
FRLNKKVSPGETKSKAKKSPSVKAKKPAAKKPKRAPGSVTVKSVKTPKKAKKPAVVGPKKAAKSPKTSKAGKPKKVVKSPAKAKAVKPKAKVAKSKAVKPKKVLPKKK*
24 >lcl|XP_001366823.1|Plus1complement(47250773..47251477) NW_001581982 dnaJ homolog subfamily B member 8-like LOC100017203 __SEG__ Chr6 {Monodelphis domestica} MVNYYEVLGVQSSASQEDIKKAYRKLALRWHPDKNPDNKDEAEKKFKQVSEAYEVLSDSKKRSMYDRSGSEGWRGGTGGAGPTYNSPFSSGYTFRNPEDIFKEFFGGMDP
FSFDFWDNPFSSDRDRDSGRGRGLRGAFSAGFGEFPAFMEAFSSFDSLGHGGRATFSSTSFGGSGSGSSGYKSVMSSTEMVNGRKVTTKRIVENGQERVEVEEDGQLKSV
IINGKEQLKWVDNK*
25 >lcl|XP_001367044.1|Plus1complement(40001429..40001716) NW_001581868 small ubiquitin-related modifier 2-like isoform 1 LOC100019003 __SEG__ Chr2 {Monodelphis domestica} MADEKPKEGVKTKNNDHINLKVAGQDGSVVQFKIKRHTPFSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGIY*
26 >lcl|XP_001367091.1|Plus15932561..5933316 NW_001581841 RING finger protein 208-like LOC100018217 __SEG__ Chr1 {Monodelphis domestica} MPAPPGPEASGWPGLLMSCLKGPQVILKMETMKIVHPEKFPELQAGAPRYTPTPRPAPALAPKRAWPSDTEIIVNQACSGDVPALEGVPRTPPPPRRPRKSSGELGFPRV
APGDEVIVNQYVLRPGPAGEPLECPTCGHTYNLTQRRPRVLSCLHSVCEQCLQILYESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSILSRLPPEALTAPPGQWGGE
AEGSCYQTFRQYCGAACTCHVRNPLSSCAIM*
27 >lcl|XP_001367196.1|Plus132081724..32082890 NW_001581956 heterogeneous nuclear ribonucleoprotein G-like 1-like LOC100018457 __SEG__ Chr4 {Monodelphis domestica} MAEADRPGKLFVGGLNIETNEKALEAVFGKYGRIVEVLLMKDRETRKSRGFAFITFESPADAKDAARDMNGKLLDGKSIKVEQATKPTFKSGGRRGPPPPPRGRGPPRGL
REGGSGGGTRGPPSRAGHMDDSGYSPNFNMGSSRGPLPVKRGPPARSGGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDNYGGPPRRDPMPSRRDVYMSPRDEGYNTKDG
YSSRDYRSSRDNRDYAPPPRDYAYRDYGHSSSRDDYQFRGYSDRDGYGGRERDYSDHPSGGSYRDSYESYGSAPPARGPPPSYGGSGRYDDYSREEYGGSRESYSSSRSD
IYSSGRGDRVGRQDRGLPPSMDRGYPPPRDSYSSSSLRAPRGGRRGSRSDRGGDRSRY*
28 >lcl|XP_001367215.2|Plus1complement(6249605..6251761) NW_001581880 disintegrin and metalloproteinase domain-containing protein 30-like LOC100012845 __SEG__ Chr2 {Monodelphis domestica} MSAVSFLGVLFLLLIYLLILFPGLSCHIQDFTFLLERGFSSYEVIIPRQLGTRSGDPEVASQVSYLLQMEGEEHAVHLQVKKLLLSRHLRLFSFTEWGARLEDQPHIPND
CNYEGYVEGFLDSRVTLNACFGGLRGILNMNGNFYQVEPLKNSTTFEHILYRLKEEATPNWTCGLTDEEVDRQLAQSQIPEVLSKIDFSESYIHQKHVELMLVMDHKRYL
TRHSNMTQVIVDCLTLSGIADTYFKTLNMHVHLIAIEVWTDKNKIDENRDSLLHVLNLFSFYKKIILYPRVLMDWTHLFVGKYFRDAGGWAWISGACKSYKASSVSILPW
EVDLYYGLAFVHEMAHGFGILHDTEFCVCSTKRCLMDTFMGGQAFSNCSFESYFNFVTKKGKCLYNIPSMVYKIEECGNKVVEPGEDCDCGSKEECRNDKCCLPTCKFKR
MAQCNSGLCCNHCHFQPSGKICRPKRTECDLAEFCNGTTNLCPNDFYKQDGTPCDYNKMGLCYHNGCHSHLQQCRKLFGSNAHNGPAGCYVQINRGDRFGNCGFTDIKYK
QCKPQDIMCGRVQCVNISDLPSMPDHTSIVQTHLGDVICWGTDYHASMASIKLPDVGEVKDGTPCGKGLICINKSCQSTSLLNYDCVPEKCNSQGVCNNKKNCHCNFGWA
PPFCIEPGYGGSIDSGPPSKWMWKRTLFRSLEAFNFSYPISFAFIFVVMWYNYLVKKK*
29 >lcl|XP_001367876.1|Plus1complement(6479911..6481317) NW_001581860 probable E3 ubiquitin-protein ligase TRIML1-like LOC100013488 __SEG__ Chr1 {Monodelphis domestica} MDVSEMTEKLRSEVTCSICLDLFSQPVTLDCGHSFCQECVLRSWQEAQVQWTCPLCRASSQPRALEPTRVLEALASSMSRQRQLPRPRDVTGQARCGQHQAVQKLFCEDD
FSPLCVSCLLPHEHEGHRVYPLEESAETFKGQLQEALGQAWAQEREAHVLLEQERARRLRCRREAAILKQVILPEYIKTHLGWTEKKQQDLLIKEKRKNMKQSRASEARI
SRYVRSLEKITEELEKTLEQPLLDMLLAGKSTLQRSRELLLCCPQPAALRWTLCGNTGMRELLLAFQSHISLDPRTAHASVIVSEDLKSVRLASHWWDLLNNLQGEAERP
LIVLGAQSFTSGSHYWEVEVGSKTEWEVGICPGPGNDQGRVHGDPLSLACLNMGERFQLWIPHALEGPEDTGTLHRLGIFLHYEGGHLSFYNVTQGCLIYAFPPVTFQGP
LRPFFSPGLIHEDNQPSAVTICPLSPHS*
30 >lcl|XP_001368149.1|Plus15500608..5501906 NW_001587047 rab GDP dissociation inhibitor beta-like LOC100013792 __SEG__ ChrX {Monodelphis domestica} MNKDYDVIILGTGLKECALGSLLASLGKKILHIDRSAQHAGSSASLSPLNVAYRHFSMSSSSSATMGRGRSCKVDLLPKFLMAKGQLVKILAHMDALRSLDLRVVEAGFL
LKGSRIYKVPSTETEALASGLMGLFEKRRFRKFFLYALNFDEQDPRTYKGLDLRKMTVKDLFRRFDLGQDVTEFTGHALALNRTNSYLERPCIEILEKIQLYTESLTKNG
KSPYLYPSLGIGELAQAFARLTSSQGGVFVTNRSVEEILIRDGRVVGIRSEGQITRCKQLICDPSYVPDRVRKVGQVIRAICILGHPVKNTNGANSGLIIVPSAQANRRS
DIYIFLTTSVHSVAVQGKYIAIVSTAVESKDPEKEILLALELLEPIEQKFFYISDLHVPNDLGTNSQIFITTSYDATAHFESTCTDIKEIYRRMTGFELKFD*
31 >lcl|XP_001368597.1|Plus1complement(56911012..56912238) NW_001581963 e3 ubiquitin-protein ligase TRIM13 TRIM13 __SEG__ Chr4 {Monodelphis domestica} MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGNVRNMLWRQSPFKCPTCRKETAAAGVNSLQVNYSLKGIVEKYNKIKVSPKMPVCKGHVGQPLNIFCLTDM
QLICGICATRGNHTKHVFCSIEDAYAQEKSAFESLFQGFETWRRGDALSRLDALETSKRKSLQLLTKDSDKVKEFFEKLQHTLEQKKNEILSDFETMKLAVMQTYDPEIN
KLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPSFNLPVNPVFKNFDTSQWEEIKLVDVDKMSLPQETVPFTNKIPWSFYQIFVVLCLVGLLVYF
TPTGSLDGSLFDDFSLWKAHLSRFSSCYLTESVEFADQAILYWEQVVDGFSVFSEKFKNYTLVLLNGMAEFVCKYKLL*
32 >lcl|XP_001368602.1|Plus19701016..9702398 NW_001581860 probable E3 ubiquitin-protein ligase TRIML1-like LOC100014294 __SEG__ Chr1 {Monodelphis domestica} MDVSEMTEKLSSELTCSICLDLFTQPVTLDCGHSFCRECVLRSWQEAQVPWTCPLCRASSRPRALESTRVLEDLTSISRQLRLPGDMCGQHQAVQKLFCEDDFSPLCVSC
LLPQEHEGHRVYPLEESAETCKGQLQEALGQARAKVREAHVLLEQERARRLRCRSEAATLKRVILPEYIKTHLVWTEKEQQDLLNKEKRRNMNRLRASEARISRYVQSLE
KMTEELQETLEQPLVEMLLAGRSTLQRSRELLLCCPEPAALCWTLCGITGMRELLLVFQSHISLDPRTAHSSLILSEDLKSVRLAFHWRDLLANLQGEAECPLIVLGAQS
FTSGRHYWEVEVGSKMEWEVGICREPGNDQGSIHGGVLSLAHLKMRNQFNLWLSHTMGNPDDTGPLHRLGIFLHYEEGHLSFYNVTQGCLIYAFPPVTFQGPLRPFFSPG
LIHEDNQPSSVTICPLSPHS*
33 >lcl|XP_001368785.1|Plus1complement(7910467..7911768) NW_001587047 rab GDP dissociation inhibitor beta-like LOC100014486 __SEG__ ChrX {Monodelphis domestica} MNKDYDVIILGTGLKECALGSLLASLGKKILHIDRSAQHGGGSASLMSPLNVAYRHFSMSSSSSATMGRGRSCKVDLLPKFLMAKGQLVRILAHMDALRYLDLRVVEAGF
LLKGSRIYKVPSTETEALASGLMGLFEKRRFRKFFVYALNFDEQDPRTYEGLDLRKTTVKDLFRRFDLGQDVTEFTGHALALNRTNSYLERPCIEILEKIQLYTESLTKN
GKSPYLYPSFGIGELAQAFARMTSSQGGVFVTNRLVEEILIREGRVVGIRSEGQITRCKQLICDPSYVPDRVRKVGQVIRAICILGHPVKNTNGANSGLIIVPSAQANRR
SDIYIFLTSSVHSVAVQGKYIAIVSTAVESKDPEKEIHLALELLEPIEQKFFYISDLHVPNDLGTNSQIFITTSYDATAHFESACADIKEIYRRMTGFELKFD*
34 >lcl|XP_001368926.1|Plus1complement(3014515..3016443) NW_001581878 heat shock 70 kDa protein 1-like LOC100023576 __SEG__ Chr2 {Monodelphis domestica} MSLAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFADSVVQSDMKHWPFQVINDGGKPKVQVSYK
GENKAFYPEEISSMVLTKMKETAEAYLGHAVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSQGERNVLIFDLGGGTFDVSILTIDDGIFE
VKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKIDK
AQIHDIVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGV
LIQVYEGERAMTKDNNLLGRFDLSGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVHDAEKYKSEDEAQREKVAAKNALESYAFN
MKNAVSEESLKGKISEDDKKKVLDKCQEVLSWLEANQLAEKEEYEHKRKELEQVCNPIVTKLYQGCGPGMGGTCGYVPPKGAPSGPTIEEVD*
35 >lcl|XP_001368952.1|Plus13017930..3019861 NW_001581878 heat shock 70 kDa protein 1 HSPA1A __SEG__ Chr2 {Monodelphis domestica} MSSTKSTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFADSVVQSDMKHWPFQVINDGGKPKVQVSYK
GENKAFYPEEISSMVLTKMKETAEAYLGYSVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRSGKGERNVLIFDLGGGTFDVSILTIDDGIFE
VKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDK
AQIHDIVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGV
LIQVYEGERAMTKDNNLLGRFDLSGIPPAPRGVPQIEVTFDIDANGILNVTAVDKSTGKANKITITNDKGRLSKEEVERMVQEAEKYKAEDEAQREKVSAKNALESYAFN
MKSAVEDEGLKGKISEEDKRKVLEKCQEAISWLDANQLAEKEEFEHKRKELEQVCNPIITGLYQGAGGPPGGSSGAHSQHSSSGTGPTIEEVD*
36 >lcl|XP_001369225.2|Plus111049668..11051602 NW_001581868 heat shock 70 kDa protein 6-like LOC100015032 __SEG__ Chr2 {Monodelphis domestica} MSAPKGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLVGDAAKNQVAMNPQNTVFDAKRLIGRKFSDGVVQADMKHWPFQVVSEAGKPQVRVSYK
GESKAFYPEEISSMVLSKMKETAEAYLGQPVSSAVITVPAYFNDAQRQATKDAGAIAGLHVLRIINEPTAAAIAYGLDRAGSSRERNVLIFDLGGGTFDVSILTIDGGVF
EVKATAGDTHLGGEDFDNRLVNHFVEEFKRKFRKDISQNKRALRRLRTACERAKRTLSSSSQASLEIDSLYEGTDFYTSITRARFEELCSDLFRGTLEPVQKALGDAKMD
KSQIHDVVLVGGSTRIPKVQKLLQDFFDGKELNKSINPDEAVAYGAAVQAAVLTGDSSHKVQDLLLLDVTPLSLGLETAGGVMTPLIQRNSTIPTRQTQTFTTYSDNQPG
VLIQVYEGERAMTRDNNLLGTFELGGIPPAPRGVPRVEVAFDIDANGILNVSATDKSTGKANRITITNDKGRLSKEQVQRMLQEAEKYKAEDEAQRDRVAAKNALEAYAF
QVKSAVQEESLQDKIKEEDRRRVLDKCQEVLSWLDANQLAGKDEYEHRRKELERLCHPIMAQLYQAPPSQGGSSCGAQARHASSTSGPIIEEVD*
37 >lcl|XP_001369559.1|Plus168116727..68118634 NW_001581835 heat shock-related 70 kDa protein 2-like LOC100022532 __SEG__ Chr1 {Monodelphis domestica} MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKG
EIKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGSAGGEKNVLIFDLGGGTFDVSILTIEDGIF
EVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLD
KGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSS
VLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTY
NIKQTVEDEKLRGKISEQDKNKILDKCQEVISWLDRNQMAEKDEFEHKQRELERVCNPIISKLYQGGPGGGGSGASGGPTIEEVD*
38 >lcl|XP_001369755.1|Plus1complement(100954199..100954510) NW_001581961 peptidyl-prolyl cis-trans isomerase FKBP1A-like LOC100021904 __SEG__ Chr4 {Monodelphis domestica} MGVQVETIFPGKGLTFPKHGQTTGIFEDGKKFDFSPDRKKPFKFVMGKQVVIRGWEEGVVQMSVSQTAKMTISPDYAYGSTRHLGAIPPNVTLIFDVELLKLE*
39 >lcl|XP_001369957.1|Plus17942052..7942996 NW_001581959 WD repeat-containing protein 82-like LOC100015998 __SEG__ Chr4 {Monodelphis domestica} MKLTDESLRSFRVAKVFQENSDKINCFDFSPNGQAIISSSDDDSIVLYDCGEGRPKRTLYSKKYGVDLVRYTHAIDTALCSSNKIDDTIRYLSLKYNKYIRYFPGHDKKV
VALSMSPADETFISASLDKTIRLWDLRVPNCQGLMYLQGKPVCAFDPEGIIFAAGVNSEIVKLYDLRAFDKGPFANFEIQQDKTCEWTGLKFSNDGKRILISTNGSFIHL
IDSFRGVVIHSFRGYNNSKAVALESSFTPDSQFIMTGSDNGKIHVWNGESGVKVAVLNGKHTGPITCLQFNPKFMTFASTCSNMVFWLPTIDDS*
40 >lcl|XP_001370298.1|Plus1complement(4353989..4354540) NW_001581897 proteasome subunit beta type-2-like LOC100016464 __SEG__ Chr3 {Monodelphis domestica} MEYLIGIQGSDYILVASDCVAASNIVQMSVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTHRNLAYYLRTRTPYHVNLLLATYDEHEGPALYYMGYLAALAKA
PFAAHGYGAFLTLSILDHFYKPSITREEAVELLKKCLEELQKRFILNLPSFSVRIIDKDGIHDLDIIVPSKKS*
41 >lcl|XP_001370427.1|Plus112616933..12618195 NW_001581996 tripartite motif-containing protein 59-like LOC100016634 __SEG__ Chr7 {Monodelphis domestica} MHNFEEELTCSICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYVRRALRIPLTCPNCRRTVEIPPPGIESLPINFALRAIIEKYEQEEHSDVITCPEHSSQPLNIYCL
QDRQPVCGHCLTVGQHQGHPIEDLHSAYMKEKEEPPKLFEQLIDTDSHWEDFWLLAEKLEEQKSHVEQVVQSDKETVLHYFKELNDILDLKKNALLSALDDVGKAIDEEF
TPHIERITEIRVEKIELKSLTAFLLDEESPLKFLKKIHSIRQRVQALRQRKLPSVQPLEICPRISPILQEEWARTEISQIKKLEVPEIKLSVQRTQCIPAEEEEKKKEEE
KADFTKIFSTLILTVISGMWMLTFLFYKDMLPILHDVRSRFFFEDSQPPDHSFFNNMHTVKETMCLTYHALKRFLWDTISDLNLTLPSSL*
42 >lcl|XP_001370437.1|Plus1complement(119152514..119153824) NW_001581961 RING finger protein 26-like LOC100024486 __SEG__ Chr4 {Monodelphis domestica} MEAVYLVLNGISLALDVLSFVLDLNFLLVSSLLAALTWMVTFIYNLPHTVLASLLHLGRGALLSLVAAVEGLTRLFLGSLQAVGVLLRGCCPGLESLKVVGHLALHVATR
GRELVHRGVLSMVSSSHALLRQACDVCAIAMSLAAYVVNSLVNICLIGTQNLFALGLALWDSMMGPLCRVTDVLGAFLAHVSSSAVAMAILLWTPCQLVLELIASAMRFL
AGFMLANLFGLVLLVIVLAVTITILHPTLAIRLAVRATEQLHALPSYHRVRGDVVRLYRLALGSESWRRVRSRSLQLASWPTGGGAPGAPQGGPRRGPSVRIRGHEQPPD
PLPRLLFRPEEGAGSGAARVAAVRGRERLNEEEPLAGHDPWQLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILLRQPAYQRNCPLCRQGILQTLNVYL*
43 >lcl|XP_001370537.2|Plus120038955..20040895 NW_001581878 heat shock cognate 71 kDa protein-like isoform 2 LOC100027477 __SEG__ Chr2 {Monodelphis domestica} MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFTVVNDAGRPKVQVEYKGE
TKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVK
STAGDTHLGGEDFDNRIVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ
IHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLI
QVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMK
ATVEDEKLQGKIGDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAAPSGGASSGPTIEEVD*
44 >lcl|XP_001370827.1|Plus1369842..371251 NW_001587042 fizzy-related protein homolog LOC100017192 __SEG__ ChrX {Monodelphis domestica} MSWSLALPPTAPVPSASKYGDRYIPSRVAANWEVHFHSKDESELSSGPKQKTEDSNSGKNRSSLVYSTALKNELLGARIQKAPSLESEENQSPQPCGPTKRNLFTYSPNT
FRWRPEIGSEMSAYAMSPISKSSQTLLTTVQREARIIPKSPFRILEAPELSDDFYLNLLDWSRHNIVAVGLGSTVFLWSATTSQVTELCDLAQEDDAVTSVSWTERGTLL
AVGTQKGVVQIWDADAEKRVATMEGHSGRVSSLAWNGSQISSGSRDRRINQRDIRAYPLQSQRWLQGHKQEVCGLKWSTDHRLLASGGNDNRLLLWNCYSLKPVQKYTAH
KAAVKAIAWSPHQHRLLASGGGSADRCIRFWNTLTGQPLQHVDTGSQVCNLAWSKQDNELVSTHGYSENQIVIWKYPSMTQVAKLTGHLYRVLYLAVSPDGQTIVTGAGD
KSLRFWNVFRKACAQKESASVLSLFTRIR*
45 >lcl|XP_001371130.2|Plus1complement(115846..118278) NW_001581913 disintegrin and metalloproteinase domain-containing protein 1a-like LOC100017631 __SEG__ Chr3 {Monodelphis domestica} MNELRKKYLFQMPQKRVWGLGLGSSTIGLGFFFLCLGMLLPGIPYAQGYYSYYEIVIPRKLTESLEKISYALLMKGKRQVIQLNLKRGLFVKDFPVYTYTKETLDLDMPF
IQDDCYYDGYVEGQLGSLVSLSTCSGLKGVITIDKSVYRIEPIGTSKEFEHVLYHMDGHVKGSCKVSGDHSKLTSNPQLRRDEDNLNEESQPVQFLNYVWSHTKYLEMFV
VVDNKRFQMWNSNVTKTAQMVMDALAHVNTYVWRIKLKVVLIGLEIWTEKDQVKISEDLQEVLYNFNHWREQVLFIRAKHDVAHLIVGHDPGEYIGEAFFSGACVSKFAA
GVETFYHEDVSHFALLMVHELGHNLGMEHDHESCICFDHPSCIMLRTITFENNFSNCSLDYFYEFLRQHKGSCLYDKPVPRGLLRKPFCGNHVVDKGEECDCGSHGDCRK
DQCCLPSCQMRMNSDCAFGPCCKKCKFLKAATPCRPSVDECDLPEYCNGTSMWCQPDTYKQDGTPCRGPGYCYQGRCRSVENQCVQIFGEGSRAARKSCYHLLNTQGDRF
GNCGSNQKGLLKVFVKCNPEDVMCGRLLCEDIPRLPQTRNHHTLIQIPIEGTWCWGMDLFEDMDDDPDGGAVKAGTSCGPQKICINRTCSDLQVLQSDCKSEVTCRGRGV
CNNLKHCHCDYGYAPPTCDSKGFGGSVDSGPTQEAGIAPLSIIAPGFPERNNPPTQAVHLNFPRAIRANVESDIIEDTSEDPLISFGPTVEIPPPIPTTPATKKIPAALV
LISALIINIILLLMLLSFIFVVFFCQKAPPIICERQEKKP*
46 >lcl|XP_001371168.1|Plus1complement(1778210..1778707) NW_001587048 thioredoxin, mitochondrial-like LOC100017681 __SEG__ ChrX {Monodelphis domestica} MAGRLILSRSLALVMARKLPMCRWVSPRTGVLQAAHKIPGTPALNLIKPLYTTRIHKITFEIQDGPDFQDRVLNSNTPVVVDFHAQWCGPCKILGPRLEKMVARQKGKVV
MAKVDIDDNTDLAIAFEVSVVPTVLAIKNGDVVDKFEGIKDEDQLECFLKKLIYC*
47 >lcl|XP_001371422.1|Plus1complement(6390948..6391916) NW_001581875 COP9 signalosome complex subunit 6-like LOC100018050 __SEG__ Chr2 {Monodelphis domestica} MASTAANGASGSSGMEVDAAVLPSVMASGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQV
FKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQH
SAIKMLHSRVKLILEYVKASEAGEVPFNHEILHEAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF*
48 >lcl|XP_001372306.1|Plus1185624018..185624344 NW_001581879 peptidyl-prolyl cis-trans isomerase FKBP1A-like LOC100029733 __SEG__ Chr2 {Monodelphis domestica} MGVKVETIYPGDRRTYPKRGQTCVVHYTGIFEDGEKFDSSRDRNKPFKFVMGKQEVIRGWEEGVAQMSLGQRAKMTISPDYAYGPTGHPGTIPPNATLIFDVELIKLE*
49 >lcl|XP_001372599.1|Plus1complement(1126388..1127443) NW_001587043 RING finger protein 113A-like LOC100019908 __SEG__ ChrX {Monodelphis domestica} MADEVSSTTPAVPVCTFLFRKSGRKGSAGRRKRPAFDKQHEGSDSSSSSSDEGNVVVRREKRRLVPNPMIQRTRGSCRERKAPTSYSGASSSGGDDESESTSAVSVVYKS
TRSAKPVGPEDMGATAVYELDTEKEHDAQAIFERSQKIQEELRGKEDDKIYRGINNYHRYVKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCG
FGDSCKFLHDRSDYKHGWQMERELDEGRYGGIEEDNYEVSSDDEDLPFKCFICRQSFRNPVVTKCKHYFCESCALTHFRTSQRCYVCDQQTNGVFNPAKDLIAKLEKHQA
EARVGTSDPLDSSDEGVTPIT*
50 >lcl|XP_001373144.2|Plus129848953..29850818 NW_001581989 ankyrin repeat domain-containing protein 57-like LOC100020767 __SEG__ Chr7 {Monodelphis domestica} MEELGQEAVLLFLTQRGGRARNAELVEHFKGALGGEPEQRARARERFKQLVNAVATVRTDPADGTKYVYLKKKFSGSGLFPPQHPAHVGALVSQVPEGGEPRAGSEHHSS
PPAGPVDLRNGDALSPPTSPRSEEPTLVVPVPDQQPRPVAALQVVPSISVTEPPELEEAPGPLDRANPANSNGPGSPEERAPLSTGEHPLSEGTLEENEPSTDPESPPQL
VSSESSRNELPRLGQVQSLGVGARRKNSRRNVPLLRGLPQGSCGGEEPELLSRNWEEGDACSSPGGVSTPRPGRKNLLDLMIGSSPQLKRSFFVGGNNPGGSSAGGSSAG
GRTTRGGGDSDTASLASSSTEEEGSGTGSVALDPLEHAWMLSASDGKWDSLEGLLTCEPGLLAKRDFITGFTCLHWAAKHGKQELLAMLVNFANKHQLPVNINARTSAGY
TALHLAAMHGHVEVVKLLVGAYDADVDIRDYSGKKASQYLSQSTAEEIKNLVGALEDDDGESTSESGGGRWKLSKVLPSHLITYKLSHVLDDGGDHHHHHHHHHSLVDGS
AGGKSMSRKASGGSSNSSRMRPRLNKIRFRTQIIHSTPSFRDPEQPLFEEERPLKSSSSSFKLRPKSNVFG*
51 >lcl|XP_001373361.1|Plus123752865..23754262 NW_001581838 probable E3 ubiquitin-protein ligase TRIML1-like LOC100021091 __SEG__ Chr1 {Monodelphis domestica} MAMAKLAENLKEELTCPVYMDYFSHPVNLGCGHSFCQPCLLRTWREVDKSCPCPECRRAFQIKDLESNHCLGKLSSLARNIRPYLLQLRMERAICERHQEEQKLFCEEDQ
TLHCVSCFESQEHSRHTVHLIEMAAEDSRDKLQKTLDLLWKEVEMIQNMLTEERQKMETWNEQADAWRESIRAEYKRLYEFLKCEEKWHLQNLSRDESKNIKNLRESETR
LSQHLQSLKEIIIDLEQNGQKPDLQLLKVGGGTLKRIKSLLSHRPEATIIQVSMAPITGIWEMMKHFRVNVTLDPESACPYLIVSENMKTVTHRGYQQYIPVAPHQFEDS
IILGAQVFTFGMHYWEVNVGESRKWAVGVCKASLSRNASVSLSTGDVFLLTHFQKRNTYSMMTTPFCIEYHSNSPIQKVGIFLGYDQGSISFYDALKNSLIFRFPAFPFS
DPLKPIFCPCPPRGEENGIPMTIDP*
52 >lcl|XP_001373497.2|Plus1complement(10100369..10100896) NW_001581903 mitochondrial inner membrane protease subunit 2-like isoform 1 LOC100021306 __SEG__ Chr3 {Monodelphis domestica} MMPPQGFGRRYMKAFLKGFFVAVPVTVTFLDQVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNYEVQRGDIVSLISPKNPEQKIIKRVIALEGDIIKTIGHKNRY
VKVPRGHMWVEGDHHGHSFDSNAFGPVSLGLLHAHATHILWPPERWQRLESILPPERAPVQMEEK*
53 >lcl|XP_001373861.1|Plus1complement(4942010..4942288) NW_001581873 dolichol-phosphate mannosyltransferase subunit 3-like LOC100021825 __SEG__ Chr2 {Monodelphis domestica} MTKLKQWISTLLVLMLIWLCLVQDVLSLGYSQKFHDVILPLPVYLLVTAGSYMLGTLGLRLANFNDCEEAAQELFQQIQEAQADLASKGLIL*
54 >lcl|XP_001374079.1|Plus1complement(45518924..45520330) NW_001581968 tripartite motif-containing protein 39-like LOC100022131 __SEG__ Chr5 {Monodelphis domestica} MAKASALESLQVEASCAICLDYLKDPVTIDCGHNFCRTCILRAWEELEEHFPCPVCRRRFPLRIFRTNRQLGNVAEIVRKLSPKCSKRRRPEEAVCEKHQQALSLFCEKE
REVVCLMCCISCEHRDHRVGPVDQAAASHKKKLRAYLGPLQRQVEDLRHFLAGEQRKPGLLREKVENRRQKLQSETEKLHHLLDEEHQAVLRRLEDEEKDILQKLSENVA
MLLDHDTMLHKLICEIQERCQLPSVEALRGIKHIVSKCESAKIPAAVSLELKEDICSFPLQHFALKKMIKKFKVDITLDPATAHPNLVLSDDRKSVKFVEKKQDLPDVPE
RFTFYPFVLGSEGFLSGRYYWEVEVGDKTEWTLGVCYDSVTRKGKINLSPADGYWRLRWDKNGYTAHTRTPNILLLKIKPKRIGVFLDYDLGEVSFYNVNDRSHIYTFAD
TFTEKLRPFFYPGVHSLPLILRPVTDWE*
55 >lcl|XP_001374393.2|Plus13086546..3086722 NW_001587050 ubiquitin-like protein 5-like LOC100022593 __SEG__ ChrX {Monodelphis domestica} MKCNTDDSIGDLKKVIVALTGTRWNKIVLKTWYTIFKDHMTLGDYEIHDGMNLELYYQ*
56 >lcl|XP_001374402.1|Plus145333425..45334558 NW_001581879 deoxyhypusine synthase-like LOC100022605 __SEG__ Chr2 {Monodelphis domestica} MEGFQEEECEEGPGSRPPLGAMATVLRHSLALPAGTIQVQGYDFNRDLDYGTLLSAFGTTGFQATSFGRAVQQVNAMIEKKLEPLGEEEENHMDLNPSCWPLSGCTIFLG
YTSNLISSGVRETICYLVQHNMVDDLVTTAGVIEEDLIKCLASKYLGEFSLKGKDLRQNGINRIGNLLVPNDNYCKFEDWLMPILDQMVLEQNTEGVKWTPSKMIARLGK
EINNPESVYYWAQKNNIPVLSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINAQAIFAKQTGMIILGGGLVKHHIGNANLMRNGADYAVYINMAQEFDGSDSGARPD
EAVSWGKIRMDARPVKVYADASLVFPLPVAETIAQKIGAFTTEKKID*
57 >lcl|XP_001374456.1|Plus1complement(3480827..3481768) NW_001587050 WD repeat-containing protein 82-like LOC100022679 __SEG__ ChrX {Monodelphis domestica} MKLTDGVLRSFRVAKVFRENSDKINSFDFSVSGETAVSSNSDDTITLYDCQEGKPKRTLYSKKYGVDIIKYTRAESTVIYSCNKIDDAIRYLSLPENKYIRYFHGHKKTV
VTLSMSPSDETFISGSIDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMIKLYDLRSFDKGPFATFRMEQDKTYEWTGLKFSKDGKHILLYTNGSCFHV
VDAFKGIVTHIFSGYNNHQALSLEAAFTPDSQFVMIGSEDGKIHIWNGENGEKVAVLDAKHTGPITCLQFNPNFMTFASACSNMSFWLPTIDD*
58 >lcl|XP_001374476.1|Plus1complement(1884267..1885868) NW_001581929 ubiquilin-1-like LOC100022717 __SEG__ Chr4 {Monodelphis domestica} MAGAREEAGDSRLVAGREPQPPRIITVTTKTPQERQEFTLAENCSVREFKEQISKRLNYDVNRLVLIFTGKILRDQDTLNQRGVLDGTTVHLVVRYRFPGFTRSCHTPAT
PASPPMSGTHATSNQPLPGSNIPGSSPSSVASGLLARLGRIARGSPDLADFLGHLTQLLMAVPEAVVQFLDDPSIQGLLGENPSSTNPSPGTGPGRLIGQPQHAPPAHTA
ETVPEALRSPALLRELLMLRADERGLGALKAVPGGDNALRQVYADIQQLMLTVPASSPRAKGPASLSGPSNSSPAAGTLRLGNMWPGTQGRVLGTPSRGNSYSTSMPNLF
MGLGPGSHDVSPTVGKDSLPGPSIPSTSALRNALHALHQNPALLHQLTTGSPLRPRLPLLPILTNPRALQAWLQIEQGLQTLSMEVPGLGPCLRGSGRPSGGHGVGIAGG
SNARVSTQQPTLAVLQLLQSLAHASPTTLQTSPPPPPPQRSPPPAEGRYQQELDQLKAMGFTNRDANLQALIATGGDIHAAIERLLGPGIPQA*
59 >lcl|XP_001375360.1|Plus138467714..38469120 NW_001581989 probable E3 ubiquitin-protein ligase TRIML1-like LOC100023956 __SEG__ Chr7 {Monodelphis domestica} MDTRDLIENLKANLTCSICLGYFTDPVIVKCGHNFCRVCLLRCREEADTTLNCPECRGVIEDRDVVPNRKLENLSMTGKRLRPHLLESMVDLYVCDQHGEKEKLFCEEDQ
RLLCDSCLLAPGHKDHTVLPLEMAAHKCKDKIKHTLNTLQRKKEEYNVALDRVGRRGRLCGNGIHSLKESVILEYRKLREFLCEEEELYLQSLDQRHTDNVVKLENNKAK
LLQKIQNLERMKIELEENLDKEPLEMLQDMKDTLARNEELLLQEPEVASFAWATRPITGLTKMLKRFQRDISFDPKSANPHLILSEDMRGVKYEDVPQDLPDNKERFNDA
IAVLGAQTFTSGKHYWEVKLGNKTELVVGVCKDSIRRKGRHSSSSKDFWILVSFRLCNDCFLWNYRDGFLMSQPLEKMGIFLDYDKKHVAFYDAIDGSLICSFSDLAFEG
PIRPYFSFCHRKEKFPASIVLINMGDSQ*
60 >lcl|XP_001375373.1|Plus160794721..60795335 NW_001581900 protein phosphatase inhibitor 2-like LOC100023972 __SEG__ Chr3 {Monodelphis domestica} MAASEASHQSIKGILKNKSTAQGSVILPRPPSSSTSSATVLRRPKPSSSRISDEDFRKKCQKWDEMNILATYHPAHKDYGLMKIDEPSTPYHSMVGENDEDALSDSETNE
TLTPEVLARKLSAAEGSDTKFLVQDETSEEEDLTPEEQEKRRQFEIKRKLHYNEGLNINLARMLISKELQGYPEEEDDDDEGKIRPGRSSQFQS*
61 >lcl|XP_001375429.1|Plus1complement(38545546..38546928) NW_001581989 probable E3 ubiquitin-protein ligase TRIML1-like LOC100024056 __SEG__ Chr7 {Monodelphis domestica} MDTRDLIENLKADLTCSICLGYFTDPVIVKCGHNFCRVCLLRCREEADAAFKCPECRGVIEDRDVVPNRKLENLSMTGKRLRPHLLESMVDLYVCDQHGEKEKLFCEEDQ
RLLCASCVLAPGHKDHTVLPLEMAAHKCEDKIKHTLNTLQRKKEEFNAALDRVRRIGNLCGNGIHSFKESVTLEYRKLREFLCEEEELYLQSLDQKHTDNVAKLEHNTAK
LSQQIQNLEKMKIELEENLDKEPLEMLQDMKDTLARNEELLLQEPEVVSFAWNTSPITGLTKMLKRFQRDISFDPKSANPHLILSEDMRGVKYEDVPQDLPDNKERFDVA
LTVLGAQTFTSGKHYWEIKVADQFEMGVCKDSIRRKGKLSPLSEDVWILISFRLCNDCFLWNSRDGFFMSQPLEKVGIFLDYDKRHVAFYDAIDGSLICSFSDMAFEGPL
RPYFSFCSGKGDNSSINFGN*
62 >lcl|XP_001375610.1|Plus138666788..38668194 NW_001581989 probable E3 ubiquitin-protein ligase TRIML1-like LOC100024306 __SEG__ Chr7 {Monodelphis domestica} MDARDLIENLKADLTCSICLGYFTDPVIVKCGHNFCRVCLLRCREEADAAFKCPECRGVIEDSDVVPNRKLENLSMTGKRLRPHLLQSITLALCDQHGEKEKFFCEEDQR
LLCASCVLSPGHKDHTVLPLEMAAGKWEDKIKHTLNTLQRKKEEFNVALDRVTKRRRLCKKAIRSLKESVISEYRKLHDFLWEEEELYLETLDQQYKNNLEKLEHNTAKL
SQQIQNLERMKIELEENLDKEPLEMLLDMKDTLARNEELLLQEPEVASLAWNTSPITGSTKMLKRFQSDISLDPESANPHLILSEDLKSFKYGDVPQDLPDNKERFDNAL
AVLGAQTFTSGKHYWEVKVGDKIELVVGVCKDSVRRKGQLSSSSEDVWILVSLRSGYLCVLCNSNYGTHWNYPIDQIGIFLDYDKRHIAFYDAMNGYLISSFSDMDFEGP
LRPYFSLCCPNGESTPGSIMLINMGDSQ*
63 >lcl|XP_001375678.1|Plus1complement(38720482..38721876) NW_001581989 probable E3 ubiquitin-protein ligase TRIML1-like LOC100024401 __SEG__ Chr7 {Monodelphis domestica} MDARDLIENLKADLTCSICLGYFTDPVIVKCGHNFCRVCLLRCREEADATFKCPECRGVIEDRDVVPNRKLENLSMTGKRLRPHLLQSITLALCDQHGEKEKFFCEEDQR
LLCASCVLAPGHKDHTVLSLEMAVDKCKDKIKHTLNTLQQKEEEYNVALDRVSSRKEICKEDIHSLKESIISEYKKVHDFLWEEEKLYLQRLDQQYTDNMAELELNEAKL
KKQFQNLQRMKFEVEENLEKEPLEMLQDMKDTLERNEEALLQEPEVISFTWDTSPITGLTEMLMSFQSDISLDPESANPHLILSEDLKSVKYGDVPQDLPDNKERFDDAL
AVLGAQTFTSGKHYWEVSLGDKTEWEVGVCKDSIRRKGKLSSSSEDVWILVSFRSGNDCFLWNSRDGFLLSRPIKKVGIFLDYEKRHIVFYDVIDGSVIFRFSDMAFEGP
LRPYFSPCCPYAENTPGSTMLINM*
64 >lcl|XP_001375704.2|Plus138782840..38784234 NW_001581989 probable E3 ubiquitin-protein ligase TRIML1-like LOC100024442 __SEG__ Chr7 {Monodelphis domestica} MDARDLIENLKADLTCSICLGYFTDPVIVKCGHNFCRVCLLRCREEADATFKCPECRGVIEDRDVVPNRKLENLSMTGKRLRPHLLQSITLALCDQHGEKEKFFCEEDQR
LLCASCVLAPGHKDHTVLALEMAVDKCKDKIKHTLNTLQQKEEEYNVALDRVSSRKEICKEDIYSLKESIISEYKKVHDFLWEEEKLYLQRLDQQYTDNMAELELNEAKL
KKQFQNLQRMKFEVEENLEKEPLEMLQDMKDTLERNEEALLQEPEVISFTWDTSPITGLTEMLMSFQSDISLDPESANPHLILSEDLKSVKYGDVPQDLPDNKERFDDAL
AVLGAQTFTSGKHYWEVSLGDKTEWEVGVCKDSIRRKGKLSSSSEDVWILVSFRSGNDCFLWNSRDGFLLSRPIKKVGIFLDYEKRHIVFYDVIDGSVIFRFSDMAFEGP
LRPYFSPCCPYAENTPGSTMLINM*
65 >lcl|XP_001375947.1|Plus1complement(2994821..2995867) NW_001581904 zinc/RING finger protein 4-like LOC100024804 __SEG__ Chr3 {Monodelphis domestica} MWGTAFHSPMPVAFLFLLLELPSSRALVRAVANDNASVVDFSDAPALFGAPLSKDGVRGYLIEAQPPNACQPIESPTLSNHSLGSIALVRRFDCTFDLKVLHAQQAGYKA
VIVHNVHSNDLVNMVHVYDDIRQQIEIPSVFVSEATSKDLRVILCGNKGAHVLLLPNLRQYPEVDCHPALSISWVLGRMMTLLIVTLIITRKVWLYCWQWREQSIVTKTP
SRKKTHMRPFPRQNDVCAICLDEYEEGDQLRVLPCTHMYHYKCINPWFSQALCRSCPVCKQPVIGAEEGSDSNPDSLSEDESTRSQLNQWATEMLTLVRQVTPDTHSSSH
RGEDSEAEGEPQRESSEP*
66 >lcl|XP_001376067.1|Plus1complement(33540457..33541863) NW_001581859 interferon-induced protein with tetratricopeptide repeats 1-like LOC100024986 __SEG__ Chr1 {Monodelphis domestica} MDENTMMDALTELRCHFTWDLLRVDNIDLTDLENRIQDEIECLDTNFRMSIHNTLAYVKLVRGQNEEALESLRKAEELIWEHYGDQAEIKSFVTWGNYAWIYYHMGEFPE
AQAYLEKVEAGCKKLLSPFRYKVELPEIDCEKGWALLKFGKEYYEEAKVSFEKALESEPDNPEFNTGFAICMFRLDLQEQYDKSISLEPLKKAVRINPEDAYLKVLLALK
LQACKQEEEGEKYLNEALNSMASKPYVLRYAAKFYCKKGYPDAGIDLLKNALRRTPTSNLLHSQMGFCYKAKVYQIKRATNFRPRGRDKQNLEKAIELSIFHFKTSIEYR
PTFELSYLELGDMYAETGDYNKAEESYQRVLNLKEIQDRTRQEVHYRFGRFNEFHRRSEVDALNHYLEALKIGKGKSLMGKGLPNSLEKFVKKRLRQNESDVETLSLLGF
IHKMKGETEKALEVYEAALGLDFSNSAF*
67 >lcl|XP_001376230.2|Plus155265717..55267849 NW_001581835 disintegrin and metalloproteinase domain-containing protein 20-like LOC100025219 __SEG__ Chr1 {Monodelphis domestica} MSTARVRPHLSAPLLVLELGALLAVVGGLQQRPSRRLVSSEVVIPLQLSSFSIAERPRRLSYLLSFGGREYVVHLHLKKLLFPRHLPVFTYTEQGSLLMDHSFIPKDCYY
RGYVEGALGSLASLNTCHGGLQGMLQVNSLFYEIEPLPASPIFQHLVSLVENKKQGPLWKCGLKEEEINRLALEKKGLRPSMSRVGSKDNGWPGIRFVKLVVVVDNFWYK
FARGNETEVIYQVLEVVNMIDSLYYPMFIYVNLNGVEIWTSNNLVEFSKGIKVTLDVFSHWKRAINDWLPHDVTRLFVRYNFGIEKSLSYVGTICNNVTSAGIDAYVEDN
LLEFSITVAHGLGHNLGMLHDYDSCICAQKQCIMYAYFGLTDVFSKCSYDSYFSQFRGRFLDCLTSPLEPYKVFPTKQCGNKVVEEGEECDCGSDEDCSKDSCCKPGCTL
RPHADCTSGPCCIKCKIAPAGTLCRPLSSPCDLPEYCNGTSVLCQKDFFMQDGTPCTKNAVCYKNICSDRIQQCKAIFGETAYDAPLICYKEADMVGNQFEECSSDDQIH
GKCDDSYTLCGKLQCTNVDHIPNLKESDSILQIYVNGVMCIGMDSHKGMGMQDTGNVHNGAVCDHGKICLNKECVNYSVLNYDCVAKKCNSNGICNNNKNCHCLQGWEPP
FCLKKGAGGSIDSGPPPERKASYTLIIYCLVSLCLGFYGILIMLFFLAKK*
68 >lcl|XP_001376240.1|Plus1complement(55304174..55306429) NW_001581835 disintegrin and metalloproteinase domain-containing protein 20-like LOC100025236 __SEG__ Chr1 {Monodelphis domestica} MGTSVVRAGFLLAFELVLLSPAGCRGQHPGWRFSSSEVVIPNQIRSRTGLRGPNKAVVAEGPGLLSYSLRFGGKRYVVHMRIKKFLLPRHLPVLVDNEHGASPEEYPYVQ
SDCYYHGYLEGIPESMAVLNTCQGGLRGTLHLDDLIYEIEPLHNSPRFEHVLSQLVPQEGEVGQSLFRCSLTSEEMNEQFSNSEFRKGLKTVPLSPWWPHIHFLKIGICV
SSSIVATHNKNLTIHIEQMITLIHLVDSIYKQFRIFTILVFLYFWQYTDKVALTGSSSEIAQRYGLWKNLVIFNSFPHDTAALITGNKAGETGYATFPNSICNGNRAAIL
LWFQDNRIFYYSIILAHYVGHNLGLRHDQIYCRCIQRSHCLMEDHPPFSDSLSNCSYGQLLNLVTYWDQCLSRLPNMYDNYPYAFNWCGNKRLDFQEQCDCGSVKECLAD
PCCDMKCHLSAGSDCAFGTCCNNCKFSAVGVVCRHAVNNCDLPEFCNGSESSCPLDSYVQDGTPCTSNAICFKGNCTDRHIQCREMFGHDGVVNADDICYEELNVKGDRF
GNCGSKPKVTYVYTYEGQQKKEVIYETVPCRKSTIFCGRLQCEGMKTLPRLDKHITFYELRVKKDKKELICFGIDYPIRAQQLDAGMVWDGSKCTENTMCLNHMCVPIAQ
LHFDCTPEKCNYRGVCNNKKNCHCQFGWSPPFCDLLGYGGSLDSGPAEKYEHYFTILSLFIFILIRIILFIIAFSFAFFTYVRKKKLLRKR*
69 >lcl|XP_001376254.1|Plus169136707..69137924 NW_001581902 e3 ubiquitin-protein ligase NHLRC1-like LOC100025259 __SEG__ Chr3 {Monodelphis domestica} MSAEASEREPALRALMREAEVSLLECKVCFEKYSHEKDRRPRNLACGHVICQGCVTALTQPRTRTLECPFCRKASKSSETSDCLPLLQFLELLGPVLCAPPSAGAGAARE
PGDPTANWVPGALTCCHSFGGWGTLINPTAMALCPRSGRVIVVHDGRKRVKVFDSDGICSHQFGEKGEAAQDVRYPLGVTATSDGHIVITDAGDRSVKVFDFSGHHKLVI
GGRFSLPWGVQTTPQQEVLVSDAGAGSLHLLVVDFQKGELRRVERLLAHLCNPRALAVSQLTGAIAITEHLLAQGSCPPSTRVKVFGPGLQLLGQVDTFGLSLFIPSKID
VTAVTFDHQGNVIVADTATQAIVCLGKPEEFPVLKPIITHGLSYPVALTYTEDNALLVLDSGVHAVKVYKTDCSF*
70 >lcl|XP_001376415.1|Plus1complement(45397327..45398622) NW_001582021 OTU domain-containing protein 1-like LOC100025496 __SEG__ Chr8 {Monodelphis domestica} MQLYSPGFSHYPSGGPATAASSPPSTATAPFKVSLQAPDPAAEAAGGDCPPATPPAAESREAAAAGMPAFSCFEMVPPGAAAPAAAPGGSCKPPLPPPPPPPPPHYTSTV
QMSVRCLGPERVGARPPEPPRRCSSSAWILEELLKPGSEAGPRSDGPDRNFRLSEHQQALAAARPRGGVSESSSRSAWGEPQPREGSPRRWESAAPTSRARSEPAPEPPS
RSNAAPSSSPASGAPKDEKLALYLAEVEKQDKYLRQRSKYRFHIIPDGNCLYRAVSKAMYGDQSLHPELREQTVHYIADHLDHFGPLIEGDVGEFIIAAAQDGSWAGYPE
LLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELARSMAISLSKMYIEQNACS*
71 >lcl|XP_001376416.1|Plus1complement(2760102..2760713) NW_001587046 protein phosphatase inhibitor 2-like LOC100025497 __SEG__ ChrX {Monodelphis domestica} METFTTKHRPIKGILKKSSPGSPILSTMGTGAGAVRGEEFSKKSQKWEELDILATYHHKDKNYEPMNIEEQNPSSHGDPEDSEEEDDDDDDDIRYSAIPHAITPELLSQR
LENDQDIEYMLLFRESESSEDEEDHKRRFELKRKLHYREGLNIKFAQQLAMKEDDSQDQEMTDLSEVDNMAMEAWHTTAPNESIQDSEMNSDL*
72 >lcl|XP_001376852.2|Plus1complement(62785947..62787239) NW_001581879 protein prenyltransferase alpha subunit repeat-containing protein 1 PTAR1 __SEG__ Chr2 {Monodelphis domestica} MAESTEEVAVLVQRVVKDINNAFKRNPHIDEIGLIPCPEARYNRSPIVLVENKLGVESWCVKFLLPYVHNKLLLYRQRKQRLNKDELIDVTCTLLLLNPDFTTAWNVRKE
LILSGTLNPIKDLHLGKLALTKFPKSPETWIHRRWVLQQLIQENSLPTFVKKESLATFPMERVQRLVQEEIEVCGEAAGRYPSNYNAWSHRIWVLQHLAKLDMKILLDEL
SSTKHWASMHVSDHSGFHYRQFLLKSLISQTVTDSAVLEQNPLVSEHISDLPKDDDEDTSAEHHRVVDLSHLLEEEVEFSTDLIDNYPGHETLWCHRRHVFYLQHHLNSK
LPHCLMRLSPMDSSGGTLNDLHLSPAVTQMTQAMDVDGLNDSNEQGYSQETKRLKRTPAQDSLGIEMEHRFIEQILSTCRNVEQARFANAYRKWLVTLSQ*
73 >lcl|XP_001376868.1|Plus1complement(74389660..74390403) NW_001581902 e3 ubiquitin-protein ligase RNF182-like LOC100026160 __SEG__ Chr3 {Monodelphis domestica} MTSQPLEDTAESPVSDELECKICYNRYNLRQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVNSLPDDNNILVNLTCAGKGKKCLPDNPTELLL
TPKRLASLVSPSHTSSNCLVITIMEVQRESPQSLSSTPVVEFYRPTSFDSVATVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVP
SSLVILMVYGFCQCVCHEFLDCMSSPS*
74 >lcl|XP_001376879.1|Plus1complement(40746090..40746692) NW_001581859 peptidyl-prolyl cis-trans isomerase A-like LOC100026176 __SEG__ Chr1 {Monodelphis domestica} MDNPNVYFNICMETEPLDPLTAEAENFQALSTGEKGFGNKGSCFHRIIPGFMCQGGDFSHHNGGKSIYGEKFADENFILKHTGPGILSMANARSNTNGSQFFFCTAKTDW
LDGKHVVSGQVKEGMNTVEAIESLDSQDGTTNKKITIADCGQNLIRFFVLFCVLTTKPILYPVTLVLSLATILFGLHFPFPSTSLARQQS*
75 >lcl|XP_001377018.1|Plus114256169..14257329 NW_001581956 dnaJ homolog subfamily C member 28-like LOC100026388 __SEG__ Chr4 {Monodelphis domestica} MKWLCVIMSPKFRYSLMVNIAMISNQMKVIPSPYILSNRMMSYYKTKKNITEYYSILHLNEGCSANEVRESFRQLAKQFHPDSGSGTADSASFIQIEEAYRMVLAHVAEK
TKQRQKKLLEEEEEEDVSTYKTPQHRHYLSYEGFGFGTPSQREKQYRQFRADRATEKVMEYQKQKLENQIYKHSVIAKNVRQSKQQKITQAIERLVEDLIQESMAKGDFD
NLSGKGKPLKKFSGCSYIDPMTHNLNRILIENGYQPEWILMQKEIKDTIKQLREDILISRNKLGHPMTSSELKQWTQICEKFQENIKKLNKRINYFNLIVPILNRQKVHF
DAEKEIARVQKTCENSIKTEKMNKKSIVNIEPEIQQTVGIKKGFLKWITPWRWGKI*
76 >lcl|XP_001377185.1|Plus1complement(14459816..14460718) NW_001581956 OTU domain-containing protein 6B-like LOC100026646 __SEG__ Chr4 {Monodelphis domestica} MESVTAEELPEEEEEEEQEQLLKRHRKEKKELQAKIQSMKNAVPKNDKKRRKQLIEDVAKLEGEMEQKHREELEHLKLTSHAKNKIDSVVVNIACLDIENQQPRISKAQK
RREKKAALEKEREERIAEAEIENLSGARHLENQKLARILAARHLEIKQIPSDGHCMYRAIEDQLKEQECLLTVATLRSQTAEYMQNHVEDFLPFLTNPNTGDIYTPEEFG
KYCDDIVNTAAWGGQLELRALSHILQTPIEVIQADSPPIVVGEEYSNKPLTLIYMRHAYGLGEHYNSVKQLMDSATENGS*
77 >lcl|XP_001377250.2|Plus1complement(1036752..1038740) NW_001581950 sentrin-specific protease 2-like LOC100026734 __SEG__ Chr4 {Monodelphis domestica} MDAVEAELLEIEEELSHSSLFFLDLAPEGLLASGGVTLPGESAPPSWHKSEESFPSTLTGFLTPKQTPEVQKDPRTGKGGSDPSEFLQFSRPHDGHTWPLGDLHSLFWSP
RRQPVLRAPAQLRKTLRNRSPAPEDIENKRPRLESSIPLEDKESAREATNSFGAAASPALGRPQASVCPGERTRGSPRALLSQISPHKRTNSGSCADGFALASQTPHGAC
RHPKKDHREPPGRLLPSCSWPRDAEVGKPGVSGGRPGMSPPEEPRGWRELLPGCSGSEGLPEERAKVRRTPCCTLEEEDAQRGKRDEDPRLGLPLPPGRHPSHLTPVPED
RRTSPQLPLKAVRNGGQGVPPACRSAAHLGPEPGRLAETCTSVDVVTSKRRSPPKERRSEPQKTTGPSSGKERWRSLLESPLSHPAPVLHTKKPHCSGQREEKSPEGLPE
LTQDMEREIERALGPGPQDEILSRTFKFRVTREDLQTLHNFQWLNDGIINFYMNLLVDRNQKQGLPRLHAFSTFFYPKLRAAGYQAVRRWTKGVDLFQQDLLLVPIHQRA
HWSLVLIDLRKKSIQYLDSLGGKEPGICTMMLQYLKEESKSRRNAELDPTEWTLDEGRSWKIPQQSNSEDCGVFLCKYADYISQDKPLAFTQNHMPHFRKRMVWEILHQQ
VL*
78 >lcl|XP_001377278.2|Plus118112745..18113647 NW_001581841 protein phosphatase 1 regulatory subunit 3D-like LOC100026778 __SEG__ Chr1 {Monodelphis domestica} MSKGPGSLVMAPSPCLRQSLSRTAPRSVSSLTDLDRGMSQEPRPSKPFSAPGPQGHQQQSGPSSCDPCLRPIIHRRARSLPSSPERRKKVSGTAGSQCRPGCSRQNRVRF
ADALGLELTQVKVFNAGEDPSIPLHVLSRLSINSDLCCSSQDLEFTLQCLVPDFPQPVDCSDFSTRLQNQRVSLERVTSSDLGLSGTIRVLNVAFEKQVTVRYTYNSWRT
QQEVGTRWRSSAGDSDVFTFCFPVPPYLLGLNSEVQFAIRYRVGGDEYWDNNEGQNYSLRCQTHPLKMPQECEESWIHFI*
79 >lcl|XP_001377382.1|Plus1complement(41121886..41122353) NW_001581837 von Hippel-Lindau disease tumor suppressor-like LOC100026927 __SEG__ Chr1 {Monodelphis domestica} MPPRLRSVNSREPLSVIFCNRTCRRVLPFWVNFEGHPTPYRMLLPGTGRRMSSYLGHFWLFRDANTGDRLLVNQTELFVPTLNENGQPVFANITLSVYTLKERCLQVVRC
LVKPEDYRKLDIVRSLYDDLEDHPDIQKDLRRLSLEYLENQVNKD*
80 >lcl|XP_001377812.1|Plus182482232..82483149 NW_001581900 peroxisome biogenesis factor 2-like LOC100027546 __SEG__ Chr3 {Monodelphis domestica} MSSNEKTTEHTNLVLRISQLDALELNKALEQLVWSQFTHCFHGFKPGLLARLEPEVKAFLWLFLWRFTIYSKNATVGQSIMNIQYKNNYSQTQKYQPLSKNQKLWYAICT
VGGRWLEERCYDLFRNHHLASFYKIKQCTNLIVGLLKLSSLVNFLIFLQKGKFATLTERLLGIRSVFCKPQNIREVGFEYMNRELLWHGFAEFLIFLLPLINIQKLKAKL
SSWCIPFTGVPNSDVTLATHGKECSLCGEWPTMPHTIGCVHVFCYYCVKSSYLFDMYFTCPKCGTEVLNLQPLKSGIEMSEVNAP*
81 >lcl|XP_001377815.1|Plus14631088..4631840 NW_001581930 RING finger protein 186-like LOC100027549 __SEG__ Chr4 {Monodelphis domestica} MSRMEGTQGRLSEGPGTDLPDSETFPVVCVHAPEQAEMAQPKSLDASIAEMEFLGPPKSAEGDLECLVCCNRYTYNRLPKMLTCQHTFCAVCLKLLLTIQGDSWTIICPL
CRKATSVPGGLICSLRDQAEVVGKLGRNGPEVQLSPQQLAQPIGGEMPIIVEEESEASTNANRVAARRLTIHLLLLVLLIFLILPFIYPGVIRWVLVFIVCLALLLSSIF
CCPPGSRGCCSPAQSPLPRQQKHSHVASIA*
82 >lcl|XP_001377836.1|Plus1complement(43843665..43843895) NW_001581978 heat shock factor-binding protein 1-like LOC100027577 __SEG__ Chr6 {Monodelphis domestica} MAETDPKTVQDLTAVVHTLLQQLQDKYQTMSDQIIGRIDDMSSHIDDLEKNMVDLMTQEGVKEIEGENKMPITCNS*
83 >lcl|XP_001378324.1|Plus1complement(87508793..87509986) NW_001581902 putative protein phosphatase 1 regulatory inhibitor subunit 3G-like LOC100028237 __SEG__ Chr3 {Monodelphis domestica} MPYGDPPLTEEDSVPRTLSLGDSGGGSGHNCPDALTQSPPSSPNGSPQLPERDASLLECELLDARRCFRTRSFSLPPGPILEAAKLLQQQQQQQQQQQRRLQAQPRDPGA
EWGTTAQEEELLSPSVCCTKCKKRVQFADSLGLSLASVKHFSVAEEPQVPPAVFYRHKSFPMRERDLEQIGDLLAAAFSPLLLEGSSFSPASARPLPRLQPLFQLPGPGN
AAPERLHLQRVCLEQVDCGAPLSLEVKGSGRVLYCAGPREVTVRYTFTEWRSFLDVPATLQSGQSAQLEVQGQEEQPGRALLGLRPRSSEEGAGDPGDLDTESFHFSLCL
PPGLLRENTEEGSPVFVVHFAVCYRCAQGEFWDNNAGANYTLSCSSGPCQLQHPAPVPPEGSFEGTL*
84 >lcl|XP_001379076.1|Plus1658358..659758 NW_001587036 fizzy-related protein homolog LOC100029292 __SEG__ ChrX {Monodelphis domestica} MSWSLTEYGSSRSSPGKHGDRFIPSRSAANWDLKFHRTQDSEKSLKEKWPSRQATSGNSPIYSALLDNELLGVGIERVQNVKGRGQRLPQPCSPEKEDLFVYSPSTEGWW
RPDAVRAASSHGMSSISSKSQALLASQKKTPKSISAKPFKILEAPELQDNFCLNLLDWSSLNIISVGLGTSVFLWHAATCQVVRVCDLSVEGDSVTSVCWSQRGILLAVG
TQKGFVHVWDVVAERRVCVLNKHSSRVSVLAWNADQISSGSRDKLILQRDLRTRAMQSRRCLQGHSGEVCGLEWSTNRRLLASSGKDNTVVLWTPASPKPVQQHTGHKAA
VKAIAWSPHQHGLLASGGCQADCAILFWNTLTNQILQSIHTGSQVGNLAWSRHTNELVSTHGSPENQIAIWKYPSLAQANKLTGHTCPVSHLTVSPDGQVIATGAADETL
RLWEVFNKTHPSRPSESTLDLFTRIR*
85 >lcl|XP_001379089.1|Plus1complement(7117030..7119291) NW_001581916 disintegrin and metalloproteinase domain-containing protein 1-like LOC100029310 __SEG__ Chr3 {Monodelphis domestica} MVEEEEEFLFRAPQMVSLRFGLSHSRVKLGVFLLLVQVFLPGTYSFIQKSVYFSVYEIIIPRRLANWKRENHPEKIQYSFFMKGRWHVMSLKQKEGLFVQNFPVYTYSNG
IPSLDISSVQGNCYYDGYFIGDRGSFASISTCSGLKGILIIEMNAFSILPVKSSRKFEHALYRLSRVSGDTCGVKNRESQKFWAKPESFSLMEFSSAHFTHAWSYPKYLE
IFIVVDNIRFQMWDKNVTTTTQTLIDVLALVNHHMKQINLEVVLAGVEIWSERNLVHISQDLQETLYDFNQWQASELPKRATYSVAHLITGQDVGSHQGHAFVGTVCASR
NLAGVEVFHQEDIPRFAALLAHELGHNLGMKHDHPDCTCPDSHFCSMHELITLKGTFSNCSLKDFYKMLGSSQGTCLYNKPKSKSPFGRQYCGNKIVEDGEQCDCGSAQE
CLKDQCCLPSCQLREGSECAFGPCCQNCRFAEATTPCRPKVDECDLPEYCNGTSRWCQPDTYKQDGFPCRDQSYCYQGRCGSLEKQCIELFGKDSRPASNRCYHMNTQGN
RYGNCGIKWHGPVQVFSQCQPQDIMCGKLYCENIQTLPHIKNHYAFFQLLMEDTWCWGVDLYNALDMPNGGLVQEGTSCGHKKICINQSCLDIEVVSRDNCSLDKCHGKG
ICNNLKNCHCNYGYEPPTCQFHGQGGSLDSGPSPRFKIVHHKLASLIWFIMVFAWLLMPIVFVGVCSYWKTDKPQIRGQDNQDSSVAREDGEV*
86 >lcl|XP_001379269.1|Plus1complement(5987306..5988106) NW_001581887 dnaJ homolog subfamily C member 30-like LOC100029549 __SEG__ Chr2 {Monodelphis domestica} MTSSPRAPRPLSSLLPVFLFSAIGSGEGSSGPLSRLIGQTCGPALQKMAAPVCRRWSQLLWTTGRKEARTSSAGGGGSSAGKNKSSDGSSRDSRTALYDLLDVPVTATQA
QIKAAYYRQSFLYHPDRNAGSPAAAERFTRIGQAYMVLSSAPLRRQYDRGLLGAEHVHAVARAPTRPPRPASPRAASATGSQRARPMPGGQHMFDFDAFYRAHYGEQLER
EQRQRARREAMRKKQEEQASSGPPWDENILVGLLLVVGLLAFVHFK*
87 >lcl|XP_001379640.1|Plus1111382315..111382608 NW_001581961 RING-box protein 2-like LOC100030027 __SEG__ Chr4 {Monodelphis domestica} MATMEDREEPGDKMFSLKKWNAVAMWSWDVEYKMCAICQVQVMDACLRCQAENKQDYVVVWGECIHSFHNCCMTLLVKQNNHCPLCQQDWVVQRIGK*
88 >lcl|XP_001379947.1|Plus145362429..45363214 NW_001581861 proteasome subunit beta type-11-like LOC100030439 __SEG__ Chr1 {Monodelphis domestica} MALENVCNWQAPEALRPHLSGAGDWAVPRGYDPRVFLQTQGPDLAHGTTTLAFRFQHGVIAAADTRSSCNNYVACPSSQKVIPVHQHLIGTTSGTSADCATWYRILQREL
RLRALREGQLPSVAGAAKLLSSMLFHYRGLGLCVATALCGWDQAGPALFYVYSDGTLLSGDVFSVGSGSPYAYGVMDRGYRYDMTIEEAYTLARQAVAHATRRDAYSGGS
VDLYHVKASGWERVSREDACVLYFRLQETGDQEEETSPASP*
89 >lcl|XP_001380079.1|Plus1complement(40400421..40400651) NW_001581841 heat shock factor-binding protein 1-like LOC100030615 __SEG__ Chr1 {Monodelphis domestica} MAETDPKTVQDLTAVVQTLLQQMQDKFQTMSDQIIGRIDDMSGHIDDLEKNIADIMTQAGVEEIEGENKIPTTRNS*
90 >lcl|XP_001380363.1|Plus1complement(116980421..116980651) NW_001581902 heat shock factor-binding protein 1-like LOC100030989 __SEG__ Chr3 {Monodelphis domestica} MVETDPKTVQDLTAVVHTLLQQRQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAAVEEIEGENKMPTTRNS*
91 >lcl|XP_001380399.1|Plus1complement(8652653..8652880) NW_001581894 heat shock factor-binding protein 1-like LOC100031035 __SEG__ Chr3 {Monodelphis domestica} MAETDPKTVQDVTTMVHTLLHQMQDKFQTMSDQIIGQIDDISSSIDLEKNIADLKTQARVEETEGENKIPPICNT*
92 >lcl|XP_001380888.1|Plus116737318..16737776 NW_001581894 heat shock protein beta-3-like LOC100031697 __SEG__ Chr3 {Monodelphis domestica} MERIVIRHPIETPVRYQEEFEARGLEDCRLDHALYALPGPTTVDRRKVRSAQNAPLTTEAEEKQPVPDSKPPFQILLDVVQFLPEDVIIQIFEGWLLIKAQHGTRMDEHG
FVSRSFTRQYKLPDGIETKDLSALFCHDGILVVEAKDRGRVN*
93 >lcl|XP_001381297.1|Plus189215191..89215787 NW_001582021 prefoldin subunit 3-like isoform 1 LOC100032236 __SEG__ Chr8 {Monodelphis domestica} MAAPRELGTTGSSSAGNRHRSHLGIPEAVFVEDVDAFMKQPGNESVDIVLKKLDEQYQKYKFMELNLAQKKRRLKNQIPEIRQTLHILKYMQKKKETPKPLETRFLLADN
LYCKASVPPTDKVCLWLGANVMLEYDIDEAQLLLEKNHSMATSNLESLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNREEAPKAGVA*
94 >lcl|XP_001381615.2|Plus1168602673..168602900 NW_001581879 heat shock factor-binding protein 1-like LOC100032657 __SEG__ Chr2 {Monodelphis domestica} MAETDPKTVQDLTAVVHTLLQQMQDKFQTTSDHIIGRIDDMSSRIDLEKNITDLMTQAGVEEIEGENKIPTTRNS*
95 >lcl|XP_001381915.1|Plus1189814681..189815817 NW_001581879 protein arginine N-methyltransferase 6-like LOC100033018 __SEG__ Chr2 {Monodelphis domestica} MSLPKKRKTDAADGGGGEGSAGEEEDGGERDPGGPGEAQESEQGARDRLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWASLRGKTVLDVGAGTGILSVFCAQAGARR
VYAVEASDIWQQAREVVRLNGLEDRVHVLPGPVETVELPERVDAIVSEWMGYGLLHESMLASVLHARAKWLKEGGLLLPASAELFLAPINDRTLEWRLGFWGEVKQRYGV
DMSCLEGFATRCLMGHSEIVVQGLTGEEVLARPQRFAQLQLDRDDLQQELQAGVGGRFSCRCYGSAPMHGFALWFQVTFPGGDGEKPLVLSTSPFHPETHWKQALLYLDE
PLQVEQDTDISGEITLSPSRDNPRHLRVLLRYKVGDQEEKTKDFRMGD*
96 >lcl|XP_003339700.1|Plus15724822..5725166 NW_001581841 notch-regulated ankyrin repeat-containing protein-like LOC100616914 __SEG__ Chr1 {Monodelphis domestica} MSQAELSTCSAPQSQRIFQEAVRKGNTKELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYS
ASGR*
97 >lcl|XP_003339754.1|Plus1<101679941..101681353 NW_001581841 probable E3 ubiquitin-protein ligase TRIML1-like LOC100032894 __SEG__ Chr1 {Monodelphis domestica} SPREMDVSEMTEKVRSELTCSICLDLFTQPVTLDCGHSFCRECVLRSWQEAQVPWTCPLCRASSQPRALEPTQVLEALASSISRQLRLPRDVGGQARCGQHQAVQKLFCE
DDFSPLCVSCLLPQEHEGHRVYPLEESAETCKAQLQEALGQAWDKAREAHMLLEQERERRLRCRREAATLKRVILPEYIKTHLVWTEDQQQDLLDKEKRRNVKRLWTSEA
RISKYVQSLRKLIEELDKTLEQPLVEMLLAGRSTLERSRELLLRCPEPAALSWTLCGTTGMRELLLAFQSHILLDPGTAHSYLSISGDLKSVRLASHWWHLLDNQQEEVE
RLVCVLGAQSFTSGSHYWEVEVGSKTEWEVGICTGPGNNQGSIHGDVLSLSCLNMGEQFELWISHTMEDPEDTGPLHRLGIFLQYEGGHLSFYNVTQGCLIYAFPPVTFQ
GPLRPFFSLGLLQEENQPIPLTICPLSPHP*
98 >lcl|XP_003339755.1|Plus1<101688564..101689976 NW_001581841 probable E3 ubiquitin-protein ligase TRIML1-like LOC100032895 __SEG__ Chr1 {Monodelphis domestica} SPREMDVSEMTEKVRSELTCSICLDLFTQPVTLDCGHSFCRECVLRSWQEAQVPWTCPLCRASSQPRALEPTQVLEALASSISRQLRLPRDVGGQARCGQHQAVQKLFCE
DDFSPLCVSCLLPQEHEDHRVYPLEESAETCKAQLQEALGQAWDKAREAHMLLEQERERRLRCRREAATLKRVILPEYIKTHLVWTEDQQQDLLDKEKRRNVKRLWTSEA
RISKYVQSLRKLIEELDKTLEQPLVEMLLAGRSTLERSRELLLRCPEPAALSWTLCGTTGMRELLLAFQSHILLDPGTAHSYLSISGDLKSVRLASHWWHLLDNQQEEVE
RLVCVLGAQSFTSGSHYWEVEVGSKTEWEVGICTGPGNNQGSIHGDVLSLSCLNMGEQFELWISHTMEDPEDTGPLHRLGIFLQYEGGHLSFYNVTQGCLIYAFPPVTFQ
GPLRPFFSLGLLQEENQPIPLTICPLSPHP*
99 >lcl|XP_003340187.1|Plus1complement(26518674..26518991) NW_001581871 e3 ubiquitin-protein ligase RBBP6-like LOC100618509 __SEG__ Chr2 {Monodelphis domestica} MSCVHYKFFSKVNYDTIIFDGPHISVCDLKKQIMKKEKLKVTNCELQISNADTEEEYTADDALIHRNVSIIVRRAPVGGIVATSRTYVLDLTKRVSRTSKAKLMH*
100 >lcl|XP_003340193.1|Plus153267904..53268197 NW_001581871 ubiquitin-like protein 5-like LOC100618004 __SEG__ Chr2 {Monodelphis domestica} MIKVVCNDQPGKKVHVKCNMNDRIGDLKKLIVAQTSNRWNKIVPKKWFKIFKDYYISLGDYELHDRMNLELYYHRSSRSANSVTPTPVFKVLLIQII*
101 >lcl|XP_003340308.1|Plus1complement(3451081..3451596) NW_001581875 keratin-associated protein 4-4-like LOC100617172 __SEG__ Chr2 {Monodelphis domestica} MVNSCCGSVCSDLSCGQDLCQETCCAPSCCRPNCCQSVCCQPNCCQTTCRPTCCRPTCCVSSCCQPCCRPSCCRPSCCRPRCCQSVCCQPTCCRPSCCQTTCCRTTCCRP
SCCVSSCCRPSCCVSSCCRPCCRPSCCVSSCCQPCCRPICCQTTCCRTTCCRPACCGSSCC*
102 >lcl|XP_003340555.1|Plus1<5652..7064 NW_001581881 probable E3 ubiquitin-protein ligase TRIML1-like LOC100012884 __SEG__ Chr2 {Monodelphis domestica} SLREMDVSEMTEKVRSELTCSICLDLFTQPVTLDCGHSFCRECVLRSWQEAQVPWTCPLCRASSQPRALEPTQVLEALASSISRQLRLPRDVGGQARCGQHQALQKLFCE
DDFSPLCVSCLLPQEHEGHRVYPLEESAETCKAQLQEALGQAWAKAREAHMLLEQERERRLRCRREAATLKRVILPEYIKTHLVWTEDQQQDLLDKEKRRNVKRLWTSEA
RISKYVQSLRKLIEELDKTLEQPLVEMLLAGRSTLERSWELLLRCPEPAALRWTLCGTTGMRELLLAFQSHIILDPGTAHSNLSISADLKSVRLASRWWDLLDNQQEEVE
RLLCVLGAQSFTSGSHYWEVEVGSKTEWEVGICTGPGNNQGSIHGDVLSLSCLNMGEQFELWISHTMEDLEDTGPLHRLGIFLQYEAGHLSFYNVTQGCLIYAFPPVTFQ
GPLRPFFSLGLMQEENEPSPLTICPLSPHP*
103 >lcl|XP_003340663.1|Plus1complement(86359594..86360037) NW_001581900 ubiquitin-conjugating enzyme E2 D3-like LOC100020459 __SEG__ Chr3 {Monodelphis domestica} MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTLSKVLLSICSLL
CDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM*
104 >lcl|XP_003340728.1|Plus1100953695..100953922 NW_001581902 heat shock factor-binding protein 1-like LOC100029533 __SEG__ Chr3 {Monodelphis domestica} MAETDPKTVQDLTAVHTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEEIEGENKIPTTRNS*
105 >lcl|XP_003340987.1|Plus1complement(478904..479131) NW_001581926 heat shock factor-binding protein 1-like LOC100619641 __SEG__ Chr4 {Monodelphis domestica} MVESAPKTVQDLTALVHTFLQQTQDNFQTMSDQIMGRIDDMSSRIDDLEKNISDLMTQARVEEIEGERKQNTNYM*
106 >lcl|XP_003341114.1|Plus1complement(15867..16607) NW_001581944 RING finger protein 183-like LOC100619584 __SEG__ Chr4 {Monodelphis domestica} MSSTQQVWHTAVPPPDLSSPTAVVPMSPVSPPAPGSPEDGSEKVSSPLECSICFTGYDNIFKTPKVLSCTHVFCLECLARLMAAQPAGQSDDSVPCPLCRQPTPVPLAGA
PALRTNQELLASLAPHLQKEEPVWMDGSKLCYRPPLPPSASEPPACICVDVGMSKPDAVQLPSPAPARRRGFLSRCSYCSDWKRILLIMVLLVILFCIVLWPVQCALKTG
NLRCFTHPPSAVNHRPTPSELPLNDN*
107 >lcl|XP_003341420.1|Plus1complement(4477530..4479647) NW_001581965 Bardet-Biedl syndrome 12 protein-like LOC100619100 __SEG__ Chr5 {Monodelphis domestica} MVMACRNINRKSHIGLQQISSLTETGRSFLGPVKSSKFIIGEGSQESVLTCSIVRLLKNLDLTCSAGQLLYETVQSQKNVYGTGTNTLLFLAGAWSVAALECLQQDIPIS
VIVSVMSEGLKSCREEVVSLQIPLCNIFDSIRDTKYPFLGTLTIIPSPLVQIPLEVPWIQRDHDKKDVSSQSSTLTFSSGSSSGLSSKLSYFTTQSLTKKNEAMSQSPKT
NIITNSHTRKSRLSHSRHFNRAEHDAYQSSNEGFPNSHFDYKCNDLVQLAVGLSHGDHSSMALVEAAVKCQYQNAHVRNSCRVPFQFDVSKISTCCLPGISESISCVCSG
YLTLVSISYKTTIRELQNKPLRVVLIDGDFKENYHHLGFNEPENVKTVLGDTAYQYQKKLWLENVLEILIQLNVNLVMVRGTVSENLIEKCMLSNLLIIGHVSHHALQDF
AEVTGAVQVVYATQLNEGCVGSGAYVSLWRPGQLNAIEQSNKIVVLLKAKGILLVTAVLASPVIAQMQAKEDIFWTCAYRLYHALLEKKVFLGGGAVEVLCLSHLQMMIE
QSLKKTDKDCSGWFPATSSWMASSQALYRPAVLKALADGWHKYLSSVVFNTGTCSSESEASTFIQNYLQKITNSGCPLLFLLKEYDKLSSKILNVGIPSRLKVTSKVYDV
VTPKFEAWRRALDLVLLVLQTDAEIIIGARNTQLNSQESDEFLLL*
108 >lcl|XP_003341655.1|Plus1complement(17498702..17498908) NW_001581976 heat shock factor-binding protein 1-like LOC100618706 __SEG__ Chr6 {Monodelphis domestica} MAETDPKTVHTLLQQMQDKFQTMSDQIIGRIDMSSRIDDLEKNIADLMTQAGVEEIEGENKIPTTCNS*
109 >lcl|XP_003341813.1|Plus161320448..61322475 NW_001581982 fidgetin-like protein 1-like LOC100030015 __SEG__ Chr6 {Monodelphis domestica} MQTPNTRSLHLSEWQKNYFDITSGNCTPGQKADAFRSQILRIQYAWANSEISQACAAKLFRKYADKYSAIIDSDNVETGLNNYAENILTIEKCQQADSSKWQSGLTIDNV
YKLNSVQEMMQAGRKFKDSLLAPADASIVIHKEVSAFAFSKPSVCGSSGEANQWIKSKCTEQMLGIPEQPASLIHPQNNQLPIMTRTTDDFPTSSVPLNELPRTKFHVTP
LFGNVKTASSTTKANKVLNISNQSFFHSGCGNPGKKRTFCDSGSESTEALSSPTLNKTLGNMETSNHRDESSPSSFKTAKEQLWIDQQKKNHQPQRAPGISYGGVKKSLG
AGRSRGIFGKFVPPLARQDGRDEKGGTQNKPPGPKPEEPAHPIDERLKNLEPKMIELIMNEIMDHGPPVNWDDIAGVEFAKTTIKEIVVWPMLRPDIFTGLRGPPKGILL
FGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDSEHESSRRIKTEFLVQLDGATTSSEERILVVGATNRPQ
EIDEAARRRLVKRLYIPLPEASARKQIVKNLMAKEHFCLTEEDITLIVRQSDGFSGADMTQLCREASLGPIRSLKAIDIATVTPDQVRPITFIDFENAFQTVRPSVSLKD
LELYENWNKTFGCGK*
110 >lcl|XP_003341860.1|Plus13562354..3563007 NW_001581989 grpE protein homolog 1, mitochondrial-like LOC100619435 __SEG__ Chr7 {Monodelphis domestica} MAAQCSGLVRRTLPAIALSLRTSSRRLCTATKQKNNGQNLEEDSSQNEQKIDSTSTEKTLIEEKVKLEEQLKETLEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCKD
LLEVADILEKATESVPKDEIKEENPHLKNLYEGLVMTEVQIQKVFKKHGLLKLNPLGDKFDPYEHEALFHTPIEGKEPGTVALVNKVGYKLHGRTLRPALVGVVKEP*