SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab O    

ID / Description / Sequence
1 >lcl|XP_001488189.2|Plus119284555..19286486 NW_001867418 heat shock 70 kDa protein 6-like LOC100051595 __SEG__ Chr5 {Equus caballus} MSTPREVAIGIDLGTTYSCVGVFQHGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNPHNTVFDAKRLIGRKFADATVQADMKHWPFQVVSDGGKPKVRVSYR
GEDKAFYPEEISSMVLSKMKETAEAYLGQPVRHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDQRGAGERNVLIFDLGGGTFDVSVLTIDAGVFE
VKATAGDTHLGGEDFDNRLVSHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGMDFYTSITRARFEELCSDLFRSTLEPVEKALQDAKLNK
AHIHDIVLVGGSTRIPKVQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQSGV
LIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPKIEVTFDIDANGILSVMATDRSTGKANKITITNDKGRLSKEEVERMVREAEQYKAEDEAQKDRVAAKNSLEAHVFH
VKSSLQEESLRDKIPEEDRCKIHDKCQEVLAWLERNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGAQARQGAPSTGLVIEEVD*
2 >lcl|XP_001488625.1|Plus1complement(3420737..3421960) NW_001867383 e3 ubiquitin-protein ligase TRIM13 TRIM13 __SEG__ Chr17 {Equus caballus} MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGNVRNSLWRLSPFKCPTCRKETSATGVNSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDM
QLICGICATRGDHTKHVFCSIEDAYAQERDAFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDLETMKLAVMQAYDPEIN
KLNTILQEQRMAFNIAEAFKDVSEPIIFLQQMQEFREKIKVIKETPLPPSNLPTSPLMKNFDTSQWEDIKLVDVDKLSLPQDTGTFISKIPWSFYQLFVVVILLGLLIFF
GPTIFLEWSLFDEFATWKDHLSNFSSYLTKSADFVELSVFSWEQVTDWFFIFSERFKNFTLVVLNNVAEFVCKYKLL*
3 >lcl|XP_001488851.2|Plus116483031..16485253 NW_001867395 disintegrin and metalloproteinase domain-containing protein 20-like LOC100053748 __SEG__ Chr24 {Equus caballus} MGPSWAQAHKTGDLWLPLLWLFLSLVCCSHARPGWRFTSSEVVIPRKVSHRVSGAEIQGQLSYKIHFRGQRHVVHLKVKKSLPPRHFPVITDDDQGAMQEDYPYVPRDCY
YYSYLEGVPGSMGTLDTCYGGLHGMLQVDDFTYEIKPLESSSKFEHVISLLVSEERSEVERCAIEEEDKDHAYEEATLAETPRAAPVYLWWPHRKYLKLHYTVTNSLYVL
DTNQTRIVENVVLINNILDTIFNQAHYRVHVRAICIWNDSDRVNLYNLATAWLALNRFGLWKWHGWYPSLPHDSSLILTARKINYLSHYAFQDGICNPNWGVAYAFVGNY
HIFLASSIAAHSLCHLFGVNHDTAGCHCFRRASCVMSAEPGLLDMMSNCTYGRMHDRASMWDPCGSIRNDPYTNFPYVAPRCGDKIINMDEECDCGSLKACSDDKCCETH
CALSTGSVCSIGPCCIGCRYAQPGKVCRDTPGICDLPEYCNGRTHVCPDDLYIQDGTPCSPLAVCVSGNCTDRDMQCQALFGHQIKDAAAICYEKLNLIGDRFGNCGVRV
TRGGGKPVTCEGDDVFCGMLHCSAVGQIPGGGDHTTFRHILADNEKCFGYDAHDGTELPEFGLVVDGATCGPGRYCLNQNCTFYQDINFDCDIQTCNFKGVCNNRRQCHC
MDGWKPPSCAERGPGGSLDSGPPPDKTLRLQTKIIFSLNKGIFLLLIRFTLFGIAILGGVCSKLEGTLEKRMEEESVEEG*
4 >lcl|XP_001488852.1|Plus1complement(18225350..18225928) NW_001867396 RING finger protein 183-like LOC100050237 __SEG__ Chr25 {Equus caballus} MAEQQGREPEAECPVCWNPFNNTFHTPKVLDCCHSFCLECLAHLSLVTPARRQLLCPLCRQPTVLASGQPVTDLPTDIAMLTLLRLEPHHVILEGRQLCLKDHPKSRYFL
RQPQVYTLDLGPEPVNQTGPLQDMASATRPMPISIPSHYSLRECSRNPQFRIFAYLMAVILSVMLLLIFSIFWTKQFLWGVG*
5 >lcl|XP_001489065.1|Plus1complement(1591469..1592680) NW_001867417 tripartite motif-containing protein 59 TRIM59 __SEG__ Chr5 {Equus caballus} MHNFEDELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCRSIIEIAPTGIESLPVNFALRAIIEKYQQEDHPDIITCPEHYRQPLNVYCL
LDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLQQLTDTHWTHLTCLIEKLEEQKSHSEKVVQGDKEVILQYFKELSDTLEQKKKKFLSALCNVGNLINQEYTP
QIERMKNIREQQLELMTLTTSLQEESPLKFLEKVDDVRQRVQTLKRRPLPELQPVEIYPRVSQVLKEDWSRTEIGQIKKLLIPEMKISSKRMSCSWSDKDEREVEFFKIL
NIVIVTLISLILMLILFFNQHIITFLNEITSICFSEVSLSVYQSLSNNLHDLKNILCHSLYLLKEFMWKIASH*
6 >lcl|XP_001489368.1|Plus142385905..42386597 NW_001867383 ubiquitin carboxyl-terminal hydrolase isozyme L3-like LOC100050355 __SEG__ Chr17 {Equus caballus} MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDK
MHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSPDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDEL
RFNAIALSAA*
7 >lcl|XP_001489983.1|Plus1complement(6050430..6051041) NW_001867431 e3 ubiquitin-protein ligase RNF152-like LOC100050623 __SEG__ Chr8 {Equus caballus} METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKLPPGFSVSQLPDDPEVLAVIAIPHASEHTPVFIKLPSNGCYMLPLPISKER
ALLPGDMGCRLLPGSQQKSVTVVTIPAEQQPLQGGAPQEAAEEEQDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG*
8 >lcl|XP_001490109.1|Plus19216023..9216487 NW_001867407 ubiquitin-conjugating enzyme E2 L3-like LOC100058286 __SEG__ Chr30 {Equus caballus} MAASRRLMKELEEIRKCGMKNFRNIQIDEANLLTWQGLIVPDNPPYDNGTFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIRSLIA
LVNDPQPEHPLRADLAEEYSKDRKNFCKNAEEFTKKYGEKRPVD*
9 >lcl|XP_001490542.1|Plus113114143..13115336 NW_001867375 dnaJ homolog subfamily A member 1-like isoform 1 LOC100050888 __SEG__ Chr13 {Equus caballus} MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQ
LSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQ
KITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPE
NGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS*
10 >lcl|XP_001490672.1|Plus110103758..10104675 NW_001867432 peroxisome biogenesis factor 2-like LOC100059654 __SEG__ Chr9 {Equus caballus} MASREEGTKRTSRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFLWLFLWRFTIYSKNATVGQSVLNIQYKNDFSPNPRYQPPSRNQKLWYAVCT
IGGKWLEERCYDLFRNPHLASFRKAKQCVNFVVGILKLGGLINFLIFLQRGKFATLTERLLGIRSVFCKPQNIREVGFEYMNREILWHGFAEFLIFLLPLINIQKLKAKL
SSWCIPLTGAPNGDSTLATSGRQCSLCGEWPTMPHTIGCEHIFCYYCVKSSFLYDMYFTCPKCGTEVHSLQPLKSGIEMSEVNAL*
11 >lcl|XP_001490694.1|Plus16778251..6779117 NW_001877043 OTU domain-containing protein 6A-like LOC100056237 __SEG__ ChrX {Equus caballus} MEDSQRMVRRHYREKKELQARIQSMKNSVPKSDKERRKQLLLDVARLKAEMEQKHQQELEKFQESFPDDSNLDSVTEDLAKMDLENQPPRLAKAQRRRERRAAEEAARLE
RIAEVEAERQAGFRHDDEEEKLSAILEARNLEMKEIPADGHCMYRAIQDQLVFPVTVESLRRRTANYLRKHVDDFLPFFSDSETGDTCSRDSFLSYCDDIVHSALWGGQL
ELRALSHVLQTPIEVIQAYSPVLVIGEEYAKKPLTLVYLRYSCSLGEHYNSVKPLEAGAVGGAAPCLF*
12 >lcl|XP_001490696.3|Plus1complement(14364916..14367669) NW_001877047 ubiquitin carboxyl-terminal hydrolase 26 USP26 __SEG__ ChrX {Equus caballus} MAPLIVHGFAQIWSGNIRMSKTKEAYIRTVEEKKKVILVVSFNTGEYTTFQLVNIKNVVFRSYGENENQLNLIFQNDDFLFIEKLSLRDGKELKMFLESFRKNNELPMRP
DRVGGVFASRTIQKEINKTSFHKVCKKSSSGSYETGEGTGIPDLQKMPLFTSKLPTRTCEELLENRCEKGKRKLSSASETNEDIPKQSNSIGNKKSKTSLLRYVSHNEKK
KLRLKESRENKKCGFSLKSNFTGNPYIDGTSLPRILYQKMYLAFLLEPKYSEDEPEWQKLKMSFEIYPEKVWEGLPNLGNTCYMNAVLQSLFSIPSFADDLLNQGFPWSK
IPLDVLSMCLAQLLVLKDIYNIKIKEKLLMSIKKIISAVAKIFSGNIQNDAHEFLGHCLDQMKENIGRINTIWKARSESEEENSPQQVFASSAATEVLVCPVVTNFEFEL
LRSIICKACGRVVLRTEVNNYLSVNLPQGPKAVPLSIQSTFDLFFGVEELEYKCEKCKHRRSVAVHKFSRLPRVLIIHLKRYSFNEFCSLRKDDQEIIISKYLKLSSHCN
ESTKPPLPLNKNAHIRDLQILKIFQKIHSEAISSLTASTKLTLESKSSLTPHAGSGKESEPQKYQILNKGTSREQQQKDLGKYSKLNIIESKLLNSGHGTIIEKELLAAS
LMMGLEDTSFSLTHEGEGKSHSGPDTRVHPQEVLEHLKLKKYEKTRMFVDFESATETTKDFSEDKKARIPEGYPKVAKQIQQCKRMRIYEQALRQALLESLPEPDAQWHT
EKLRRPTEVTLQEANVSSLGALGSNKNPGNKDVLDKEKTETKAKKPKRNAEIRDRHAYQLIGVVSHLGQTPNSGHYISDAYDFERQVWFTYNDLLVSSIQEALMQEARLC
TGYIFFYMHNEIFEELVGREEKFQSSNANAGETPQGE*
13 >lcl|XP_001490880.2|Plus1complement(7291668..7294283) NW_001867429 disintegrin and metalloproteinase domain-containing protein 1a-like LOC100057504 __SEG__ Chr8 {Equus caballus} MSVAASVRDSASILPSLWKNQVALKEGQIKFQTWAQKRNLRLGPVRGSSCVRLGIVLLLAIFLPSMYCDLGVVYYTFYEIIIPKQWTVNGKEDPVEKASYMLLMQGQKQL
IHLKVKRDYFVDNFPVFSYHNGILGQEMPVLAHDCHYEGYIEGVPGSFVSVNTCSGLRGVLIKEGKSYGIEPVGASKKFEHVLYTMAREARISCSVTSKDSQVVSTSQQR
GSRKPRSAQALSYLWSHTKYVEMFVVVSNQRFQMWGSNVNETVQRVMDVIALANAFTRGINTEVVLAGMEIWTEGDLIEVPADLQVTLRNFNSWRQDKLFHRVKHDVAHM
ILGHRPQEDTGQAFLNGACSTGFAAAVESFHHEDVLLFAALMVHELGHNLGIQHDHSACTCKDTHFCLMHENITKESGFSNCSSDDFYQFLLDHKGACLFNKPQHKGRVR
RDAECGNGVVEEDEQCDCGSACDDHPCCDPACKLKEGAECSDGLCCLNCRLRNVGFMCRPPSGECDLPEYCDGNSEACPTDSYKQDGTSCDLIHYCLGGRCRNPDTQCID
IYGYPARSAPEDCYITMNSKGDRFGNCGHPTLARSRYVKCVDDNIFCGKLICTNIRNVPRLKPQHTVIQFTHKDDFCWSIDAYNTTDIPDDGDVHTGTYCAPNKVCVNYS
CTDHTVLNYDCEPAEMCNGKGVCNNLRHCHCEAGYAPPDCRDPGNGGSVDSGPPGKSDDGNPSEDESRSHSVDRDIKSLGMIVFILPVFLILLLLILILIISLSAGIESV
ETPGGSTILSSEESTEVPEEEAPPPEEAPPPEEAPPPEEAPPLDQAPPPEAPPPEAPPPEAPPPEAPPPEAPPPEAPPPEAPPPEAPPPEAPPPAQETPAP*
14 >lcl|XP_001491564.1|Plus1complement(38766967..38767764) NW_001867396 RING finger protein 208-like LOC100058717 __SEG__ Chr25 {Equus caballus} MPSDLGPEGGSGWPGLLMSCLKGPHVILKMEAMKIVHPEKFPELQAAAPCFPPAPRPTPALAPKRAWPSDTEIIVNQACGGDMPALEGTPRTPPLPRRPRKGSAELGFPR
VAPADEVIVNQYVIRPGPGTSGASAVAAPAAGEPLECPTCGHTYNVTQRRPRVLSCLHSVCEQCLQILYESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSILSRLPP
EALTAPAGGQWGGEPEGSCYQTFRQYCGAACTCHVRNPLSACSIM*
15 >lcl|XP_001491787.1|Plus1complement(34719544..34720167) NW_001877040 putative type-1 protein phosphatase inhibitor 4-like LOC100058948 __SEG__ ChrX {Equus caballus} MAASTTSQHRPIKGILKNKGSTASSMAASTQQSGGATQEVQRKKSQKWDESNILATYRPAYRDHELMKTNEPSSPHLSVQDDGEDAMSDLEAKEVMTLDILALKLAVTDM
SESNYQVVEPESHGAHTSKIFVDIQEKHQQFEMKRKLHYNEGLNIKLARQLISKELQLEEEDKNEESLHATNEEKTTTEESDEGPDGDQLQTQGRYA*
16 >lcl|XP_001491864.1|Plus1complement(3919022..3920056) NW_001877047 RING finger protein 113A-like LOC100058519 __SEG__ ChrX {Equus caballus} MAEELSPGKMTEQVCTFLFKKPGRKGAAGRRKRPVRDQERGDSSSSSSEEGSTVVRPEKKRATHNPMIQKTRGSGKQKVAYGDLSSEEEEEKEPETLGVVYKSTRSAKPV
GPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKF
LHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEEIPFKCFICRQTFQNPVVTKCRHYFCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRAAEEGGAS
DFPEDPDEGPIPIT*
17 >lcl|XP_001492044.1|Plus1complement(31550871..31552796) NW_001867389 heat shock 70 kDa protein 1-like LOC100050904 __SEG__ Chr20 {Equus caballus} MAAAKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINDEGKPKVMVSYK
GEKKAFYPEEISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKAGQGERHVLIFDLGGGTFDVSVLTIDDGIFE
VKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKALRDAKMDK
AKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGV
LIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLEAEKYKAEDEAQREKISAKNALESYAFN
MKSAVSDEGLKGKISESDKKKILTKCNEVLSWLEANQLAEKDEYDHKRKELEKVCNPIITKLYQGGCAGPACGRGYTPGRAATGPTIEEVD*
18 >lcl|XP_001492544.1|Plus1174598..176913 NW_001867373 e3 ubiquitin-protein ligase TRIM56 TRIM56 __SEG__ Chr13 {Equus caballus} MVSQGSAPSLLEALNSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLAEDGHLRCPECRETVPVPPAGVAAFKTNFFVNGLLDLVRARAGGDLRAGKPACALCPLMGGA
SAGGPATARCLDCADDLCQACADGHRCTRQTHTHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFLCQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEELL
AGVDNNLAELEASRMAEKEALARLREQAARVGTQVEEAAEAVLRALLAQKQEVLGQLRAHVEAAEEAARERLGELEGREQVAREAAAFARRVLSLGREAEILSLEGAIAQ
RLQQLQGCPWMPGPTRCLLPQLELHPGLLDKNCHLLRLSFEEQQSQKDGGKDGAGTKGCDKTQSWREDGTQTEKHGGIQPQSRDGAQTPKEDRAQTPQEDGAQTPKAEIA
KTPQEDGTQTPKEARAQTPQEEGGALTPRGGRSNKKKKFKGRLKSVSREPSPAPGPHLEGSGLLPRPIFSCSFPTRMPGDKRSPRITGLCPFGPREILVADEQNRALKRF
SLNGDYKGAVPVPEGCSPCSVAALQGAVAFSASARLYLISPDGKVQWRRALSLSQASHAVAAMPSGDRVAVSVSGHVEVYNMEGSLATRFIPGGKANRGLRALVFLTTSP
EGNFVGSDWQQNSVVVCDGLGQVVGEYRGPGLHGCQPGSVSVDKKGYIFLTLREVNKVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHVFRVRSPD
S*
19 >lcl|XP_001493051.1|Plus142646511..42648001 NW_001867387 probable E3 ubiquitin-protein ligase makorin-3-like LOC100060875 __SEG__ Chr1 {Equus caballus} MEEPAAPSEPSGAARAPVGAVAAGEGAAGPSVPVRPASRQPVAPSPALLRTSRRRPAQASGGGAGPSWLPSRSTGSWTKQITCRYYLHGMCKEGENCRYSHDLSGRQMAR
ESRSSSPQASTDRGASTAAHVETLPQEVAEAPPAASSRSLPVIGSAAERGFFEAARYNVGLEAAGGAGAEGWADAVEFVPGQPYWGRSTFTVPKAHLQSLVTAREQIAVG
VGEQLCRDAAMGRCFRGESCMYQHGEICDMCGLQVLHPVDAVQREEHIRACVEAHEKDMELSFAVQRSMDKVCGICMEVVYDRVNPSDRRFGILSNCNHAYCLRCIRRWR
SARHFGSRLVKSCPQCRVTSNFVIPSEFWVEEEEEKQKLIQQYKEAMSNKTCRYFAQSGGFCPFGENCFYKHADPEGLGEEPVQVGEGNMPFKRCKKELVMLRLANLLFK
CFLSVGDNELPFLEDQWDLLHYELEKIFKFESVALCCGMWSSVLRLCHPLLPVFCL*
20 >lcl|XP_001493804.1|Plus1complement(9061637..9062149) NW_001867420 ubiquitin-like protein 4B-like LOC100062023 __SEG__ Chr5 {Equus caballus} MFLTVKLLLGRRCSLKVSGQESVAMLKKLVSKQLQVPEEQQHLLFRGQLLADDKHLSDYCIGPNASINVIMRPLEKSVPEEAHQSHPLWHHLRRVLAKHFGPQDTKAVLQ
VLRQEHEERLQRISLGDLEQLARYLLTEEPLVEPAAEREPEATTSEPPDQEAEEKGKADQ*
21 >lcl|XP_001494421.2|Plus115458125..15458979 NW_001867398 protein phosphatase 1 regulatory subunit 3B-like LOC100062982 __SEG__ Chr27 {Equus caballus} MAVDIECRYSCMAPSLRRERCAFQISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADTQGLALTMVKVFSEFDDPLDIPFNITELLDNIVNLTTAESESFV
LDFSQPSADYLDFRNRLQTDHVCLENCVLKDRAIAGTVKVQNLAFEKTVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECSGQTY
WDSNKGKNYRIIRAELKSTQGTAELPNGPDFGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY*
22 >lcl|XP_001494472.1|Plus1complement(33156158..33157765) NW_001867398 ubiquitin carboxyl-terminal hydrolase 17-like LOC100063044 __SEG__ Chr27 {Equus caballus} MEPASLHSRDESQFNVFPTLRPSWSSASGAEAHWGLSLIEKPSPLSQEVCNLQDGFAPVSTGPAPAKKRLLSWKRPYVVGAGLQNMGNTCYVNAALQCLTYTPPLASYML
SQQHSKTCQNQRFCTLCAMQVHITRALYHPGDVIQPLPELVTGFHRRRQEDAHEFLMFTLDAMQQACLSEYKQVDGHSDNTLVRQIFGGYWRSQIQCLHCHGVSDTFDPY
LDVTLDIKAALSVNQALEQLVKPEKLDGENSYHCSMCLKKVPASKTLTLHTSSKVLMLLLKRFSNFTGSKMPKDVQYPEYLDMQQYMSQQNSGPLLYVLYAVLVHAGWSC
HNGHYFCYIKAGNGQWYKMDDAKVTACDVTSALSQCAYVLFYIQKSELERDSGSVFIDGKPRSLVADHPTMVAAKWEPERDSSVRVPESEKHMGDTSVKQITLDQWRSLQ
EHKRLKPEFNLRRIDSALPAHAVVIHRSKYRDRMRKNQPEQENYRLNNSARGSPAQGAMNMGKVLCLGGRARATKRKNKQGQRSLDAFQQSRYRL*
23 >lcl|XP_001494656.2|Plus16033183..6033461 NW_001867419 dolichol-phosphate mannosyltransferase subunit 3-like LOC100063346 __SEG__ Chr5 {Equus caballus} MTKLAQWLWALALLGSAWAALTMGALGLELPSSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGMRF*
24 >lcl|XP_001495902.1|Plus113500872..13501615 NW_001867389 e3 ubiquitin-protein ligase RNF182-like LOC100065188 __SEG__ Chr20 {Equus caballus} MASQPPEDAAESQGSDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLL
TPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSVRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVP
SSLVILMVYGFCQCVCHEFLDCMTPSS*
25 >lcl|XP_001496199.1|Plus1complement(11916941..11919298) NW_001867404 disintegrin and metalloproteinase domain-containing protein 29 ADAM29 __SEG__ Chr2 {Equus caballus} MTMIETLLYMRITLLIHWLAVFLSSSGHMWPENPQYHSPPEVVIPLKLPRTGRGMKPPGMLSYSLHFGGKRHVVHLRVKKHLLSRHLPVFTYTDQGALLEEKPFVQNDCY
YHGYVEGDLESLVALSTCSGGFQGLLQINSIVYEIEPMDFSPKFEHLVYKMDETQFPTTKSDIMQEDTVHQLEFQETDNYTLKQSSYVGWWVHKFLVEMAVIVDHTLYLH
YEKNVSKLQDDLYVIVNIVDSIYEVMGIKLLLLGMEVWTEKNYFEVGDISRSLKQFCEWKSKNFAPRVSHDTAHLFTYKTLRGLTGLGFVAGLCKSHRNCAVVTCVNKTL
SIIGIAMAHHLGHNLGMFHDADECKCAHPTCIMRYDNPPITQFSNCSYNFFWEYSIRQAKCLMYTVHTKDVFTMKRCGNGIVEEEEECDCGILRSCSKDPCCLSNCTLSF
GSICAFGLCCKDCEFLPSGRVCRKKVNECDLPEWCNGTSHMCPDDVYVEDGIPCNSSAYCYEKSCHNRDEQCRQIFGQEAKSANNSCYKRVNTKGDRFGNCGFKDFSYVK
CDSSDSLCGRVQCENVTKIPLLSDHSTVHWTRVNGAICWGIDYHFGMTTPDIGDVKDGTECGPEHVCIHRKCVHLSRLDSNCSPKFCNMRGICNNKHHCHCNYMWDPPNC
LIRGSGGSIDSGPPPKREKIKKIYVLGFVLFWLIVLLCCLLLLCKKKKSKKKDQKVQAEVKKAENVKTQQPKENQNVPTQQGKHFQNVPVQPAKEGQKLQHQSSVSISQS
QRGKQNQSIQKGVSK*
26 >lcl|XP_001496609.2|Plus1complement(16944280..16945467) NW_001867389 e3 ubiquitin-protein ligase NHLRC1 NHLRC1 __SEG__ Chr20 {Equus caballus} MGAEAPGSGPALRELVREAEISLLECKVCFERFGHRQQRRPRNLPCGHVVCLACVAALAHPRTLALECPFCRRACRGCDTSDCLPVLHLLELLGSALRTAPAAHCAAPCG
PGALTCHHTFGGWGTLVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPLDVTVTNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWG
VETTPQNGVVVTDAEAGSLHLLEVDFPEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLERPLALEPGACSTTVKVFNATMQLIGQVDTFGLSLFFPSKITASAVTFDHQ
GNVIVADTSSQAVLCLGKPEEFPVLKPIITHGLSHPVALTFTKENALLVLDSAAHSIKVYKVDWA*
27 >lcl|XP_001496662.1|Plus1complement(19581853..19582335) NW_001867366 heat shock protein beta-9-like LOC100066284 __SEG__ Chr11 {Equus caballus} MQRVGSGLPNGSQVASRRPSVALAEQNQVATLPVRLLRDDVAAVPDDVHAKDGFQMKVNARGFTPEELMVQVDGRFLMVTGQRQLEGCSSNGYSYRMAQQVHQQVQLPPD
LDPTAMTCCLTPSGQLCFRSQSPALPSPEAQTGPSPKLRSRGSKKGSNLA*
28 >lcl|XP_001497229.1|Plus1complement(13722045..13722497) NW_001867391 heat shock protein beta-3-like LOC100052250 __SEG__ Chr21 {Equus caballus} MAKIILRHLIETPVRYEEEFQARGLEDCRLDHALYALPGPTTVDLGKARAAQPPPADSAAEIPPQAGKSRFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGNRMDEHGFI
SRSFTRQYKLPDGIETKDLSAILCHDGILVVEVKDPVETK*
29 >lcl|XP_001498019.1|Plus1complement(30157528..30158688) NW_001867397 dnaJ homolog subfamily C member 28 DNAJC28 __SEG__ Chr26 {Equus caballus} MNTMYVMMAQILRSHLINASVVPNRRKMLPYLGVIRNRMMSTHKSQKRITEYYRLLNLDEGCSADDVRESFRKLAKQYHPDGGSGTADSATFIRIEEAYRKVLSHVIEQT
NARQSKVEEAEEEEEKFKYKTPQHRHYLSFEGIGFGTPSQREKQYRQFRADRATEQVMEYQKHKLQSQYFPNSVTVKDVRQSKEQKITQAIERLVEDLIQESMAKGDFDN
LSGKGKPLKKFSGCSYIDPMTHNLNRILIDNGYQPEWILMQKEIKDTIDQLREAILVSRKKLGNPMTPTEQKQWNQVCEQFQENITKLNKRINDFNLIVPLLTRQKVHFD
AQKEIARAQEIYETLIKTKQVRDKNPNNIDQGEGEKTPGVKPGFLNWMNVWKFIKI*
30 >lcl|XP_001498034.2|Plus1complement(22037622..>22038239) NW_001867392 zinc finger CCHC domain-containing protein 3-like LOC100068090 __SEG__ Chr22 {Equus caballus} DIYAVIQIPGSREFDVSFRSAEKLALFLRIYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEG
GVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGSCTQDRCFRCGEEGHLSPYCRKGIVCNLCGKRGHAFAQCPKAVHNSVAAQLTGVAGH*
31 >lcl|XP_001498128.3|Plus1complement(20912297..20913709) NW_001867404 tripartite motif-containing protein 75-like LOC100068208 __SEG__ Chr2 {Equus caballus} MAVEAALAGLQAEANCPICLDYLRDPVTIECGHNFCRSCIQQSWEDRWDMFPCPVCRHPCQQRHFRSNAQLGRMIDVTKLLHITRNKKKRQEERRLCEKHNQVLTLFCEE
DLEVLCALCTQPPDHQGHQVRPLEEAASHHRQRLSSYIEPLKKQVADVQKLISIQSKKPLELREKVQNQRRKLASEFEHLNRSIAREQEAVLARLAEEERDIHRKLSANI
TACSDHISTLRGLLKEVAERCAMSEVRLLTDIRSILHRCERLDPPAPYSIQLRKEGCSLPPQYSALRKIIQKFKEEVTLDPETAHPNLLVSEDKKAVTFVRKKQRVPRNP
KRFTVDPVVLGSEGFDCGRHYWEVQVDDKPAWAVGVCTDSLSRKGKRPPSGHSRRWTIQLQNGDYVAQGAVPVPLVLKEKPRGVGIYLDCELGNISFYSLNDRSHVHSFT
DTFSEVLKPYFCIGRDSQPVMVCAARDYEG*
32 >lcl|XP_001498191.1|Plus120949308..20950690 NW_001867404 tripartite motif-containing protein 75-like LOC100068280 __SEG__ Chr2 {Equus caballus} MAFAASLAELQAEASCPICLDYLRDPVTIHCGHNFCLSCIHQRWEDLQVIFPCPVCLHHCPDRNLKKNSQLRHMTEIVKQLPTTRSKRKGQEETPLCEKHSQVLGLFCEE
ELELLCPQCGVSSDHRDHLVTPIEQAAASHRRRLKSYIEPLKKQVEDAELEREILVAKSPIEVQQKMKNWRGELHSEFEELKDFLRKEQVAIRGRLLMQKKDVEDKLSQY
QSQISNHMSRLQNLISEITEKRFQGDLAFLTDIERIYNRYEQLKAPEDFSYELKEESCNFPPHYFGLQKMISTFQVDLTLDPETAHPNLIISKDRKSVIYRTMKPNCLDN
PEAFTSYLAVLSCEGFDAGRHFWQVEIRGTGEWCLGVCKNFPRNALIPPCPKDVCGQFQQGTRTCGTGYTRQVMRIGVFLDYELGEVSYYNWHSRSYLYTLTDTFTGKLI
PYFSVGLSSRSLTISIVLDE*
33 >lcl|XP_001498222.1|Plus120985832..20987244 NW_001867404 tripartite motif-containing protein 75-like LOC100068320 __SEG__ Chr2 {Equus caballus} MAVEAALAGLQAEANCPICLDYLRDPVTIECGHNFCRSCIQQSWEDRWDMFLCPVCRHPCQQRHFRSNAQLGRMIDVTKLLHITRNKKKRQEERRLCEKHNQVLTLFCEE
DLEVLCALCTQPPDHQGHQVRPLEEAASHHRQRLSSYIEPLKKQVADVQKLISIQSKKPLELREKVQNQRRKLASEFEHLNRSIAREQEAVLARLAEEERDIHRKLSANI
TACSDHISTLRGLLKEVAERCAMSEVRLLTDIRSILHRCERLDPPAPYSIQLRKEGCSLPLQYSALRKIIQKFKEEVTLDPETAHPNLLVSEDKKAVTFVRKKQRVPRNP
KRFTVDPVVLGSEGFDCGRHYWEVQVDDKPAWAVGVCTDSLSRKGKRPPSGHSRRWTIQLQNGDYVAQGAVPVPLVLKEKPRGVGIYLDCELGNISFYSLNDRSHIHSFT
DTFSEVLKPYFCIGRDSQPVMVCAARDYEG*
34 >lcl|XP_001498326.1|Plus1complement(20331822..20333855) NW_001867412 fidgetin-like 1 FIGNL1 __SEG__ Chr4 {Equus caballus} MQVSNSRSVHLSEWQKNYFALMSDICTSGQKADAYRAQILRIQYAWANSEISQVCATKLFKKYAEKYSAIIDSDNVESGLNNYAENILTLVRSQQTDSDKWQSGLSISNV
FKMSNVQEMMQAGKKFKDSLLAPADASVVIHKEAAVFDLPKFSICGGSGESDPLTKSALGIDRTQDIPESSPSLKCPQNAQPPMVTNATKMCSIFSTPFGESGTAKFHAT
PLFGNVKKENNNSPKANIGLNMFSSNQSCFPSGCENLQERKAFYGSGIIDALSTPILSKAPTKTEDTGQREESSLPTFKTAKEQLWVDQQKKHHQPQRASGSSYGGIKKS
LGASRSRGIFGKFVPPVPKQDGGDLNGGMQYKPYGAGPTEPAHVVDARLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGI
LLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNR
PQEIDEAARRRLVKRLYIPLPEASARKQIVVNLMSKEQCCLSEEEIELVVQQSDGFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYVDFENALRTVRPSVSP
EDLELYENWNKTFGCGK*
35 >lcl|XP_001499445.2|Plus16564811..6565191 NW_001867364 prefoldin subunit 1-like LOC100069659 __SEG__ Chr10 {Equus caballus} MRNQAGAPVDLELKKVFTELQAKAIDTQQKVKLADIEIEQLNRTKKHAHLTDTEIMTLVDETNIYQGVGIMFILQSKEVIHNQLSEKQKIAEEKSKESEQKKSYQQWSMK
EAEDNIREMLPARRAQ*
36 >lcl|XP_001499576.1|Plus1complement(32861952..32862239) NW_001867396 small ubiquitin-related modifier 2-like LOC100069857 __SEG__ Chr25 {Equus caballus} MGDEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY*
37 >lcl|XP_001499899.1|Plus1complement(21007273..21008691) NW_001867404 tripartite motif-containing protein 60-like LOC100061588 __SEG__ Chr2 {Equus caballus} MEFVTALADLQAGASCPICLDYLKDPVTISCGHNFCLSCINMFWKDLNDTFPCPFCRFCCPERKFTSNLQLGNLTEIAKLLQIRRSKRKRQEENLVCEKHNQLLAFFCQK
DLEVLCAQCSFSTDHRNHYVWPIEKAAAYHRKRLEHYIEPWKERVERVEKVITMQTRKSLELKKKVEYRREEIKSEFEQLTLFLQNEQETVLLQLEDEEMDILSKLNENL
TKFSDHVSTLKCLLKEIQSKYVKSELELLTDVKSMYHRYKTLKAPEPFSFQLKEYGYCLPPQYSGLNKIKRFQVDVILDPETAHRKLIVSEDRKTVEYRNTLQNLPHNPR
RFYLCTAVLGSEGYDSGRQYWEVEVKDKPEWILGVCKDSLPRRRRNQNQLMLARDGLWGIGRCSESNYIALGPKKINLLPAVIPSKIGIFLDCDLGEVSFYNLNDRSLLY
MFNDSFTEACWPYFYAGTDSKPLKICTITDSE*
38 >lcl|XP_001500339.1|Plus112875288..12876052 NW_001867425 proteasome activator complex subunit 3-like LOC100061423 __SEG__ Chr7 {Equus caballus} MASLLKVDQEVKLKVDSFRERIASEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGIKVFVMPNGMLK
SNQQLVHIIEKVKPGIRLLIKKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLI
ISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY*
39 >lcl|XP_001501008.1|Plus174618367..74619302 NW_001867411 heparan sulfate glucosamine 3-O-sulfotransferase 1-like LOC100056091 __SEG__ Chr3 {Equus caballus} MAALLLGAVLLVAQLQLMPCRPAAPGAEPGQQELVGKAATLQNEVRAGAAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHFSQGLGWYLSQ
MPFSAPHQLTVEKTPAYFTSPKVPERVHSMNPSIRLLLILRDPSERVLSDYTQVFYNHVQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVD
GDRLIRDPFPEIQKVERFLKLAPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH*
40 >lcl|XP_001501016.1|Plus19879433..9880032 NW_001877044 peroxiredoxin-1-like LOC100071709 __SEG__ ChrX {Equus caballus} MSSGNAKIGHPAPNFKATALMPDGQFKDINLADYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASIDSRFCHLAWIKTPKKQGGLRPMNIPLVSDPKC
TIAQDYGVLKADEGISFRGLFIIDDKGILRQISVNDLPVGHSVDETLRLIQASQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFLKQK*
41 >lcl|XP_001501484.1|Plus1complement(41889588..41890625) NW_001867389 tubulin-specific chaperone C-like LOC100054793 __SEG__ Chr20 {Equus caballus} MEAGSCSAVGVGNGDVGSQRDRGLVPERLQRREQERQLEVERRKQKRQDQEVEGETSDFFAAAFARERAAVEELLEGGESGERLEEAAARLQGLQKLLNDSVLFLAAYDL
RQGQEALARLQAALGERRQELQPKKRFAFKSRRKDAAPAAEVNAAAGAQAAKGSRASPPPVKEEGGFGSSYVCGFSNVESQVLEKRAEELHQRDVLLTGLSNCTIKLYGN
PNTLRLTKARRCTVLCGPVSTSVFLEDCSECVLAVACQQLRVHTTRDTRVFLQVTSRAIVEDCSGIQFAPYTWSYPGIDEHFEGSGLDRSKNNWKDVDDFNWLSRDEASP
NWSILPEGERMVQWD*
42 >lcl|XP_001501779.2|Plus134294983..34295678 NW_001867402 RING finger protein 186-like LOC100071883 __SEG__ Chr2 {Equus caballus} MACTEVPQQPAPQQPQPLSTEATTTNATGSAGGHRGSWDSDLECLVCREPYSCVRLPKLLGCQHSFCAICLKLLLCVQDDTWSITCPLCRKATAVPGGLICSLRNQEAVM
GLLDRPCPEVRLCPQGLVDPATLAAGHLSLAGEDGQDVANANRVAARRLAAQLLLLVLLITLILPFIYPGITKWVFISIIILAFLMLTLFCCHSSSQASYWPSSRTLFCT
GQKHGEIAYIA*
43 >lcl|XP_001501807.1|Plus149863445..49864638 NW_001867391 dnaJ homolog subfamily A member 1-like LOC100054696 __SEG__ Chr21 {Equus caballus} MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQ
LSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQ
KITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPE
NGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS*
44 >lcl|XP_001502246.1|Plus1complement(53010985..53011896) NW_001867413 RING finger protein 148-like LOC100056342 __SEG__ Chr4 {Equus caballus} MSLLRIAPSTHSCVSSRLLKLSIFLLLSLPDSKGKAIWTAYLNITFQVGNRIISELGESGVFGNHSPLERVSGVVVLPEGWNQNACNPMTNFIRPEQADSWLALIERGGC
TFTHKINVAAEKGANGVIIYNYPGTGNKVFPMSHQGTENIVAVMIGNLKGMELLHLIQKGVYVTIIIEVGRMHIPWINHYVMSLFTFLAATVVYLFLYCAWRARVPNSSS
SRRRQIKADVKKAIGQLQLRVLKEGDKELDPNGDSCVVCFDIYKPQDVVRILTCKHFFHKACIDPWLLAHRTCPMCKCDILKT*
45 >lcl|XP_001502468.1|Plus133394328..33395140 NW_001867364 ret finger protein-like 4B-like LOC100072480 __SEG__ Chr10 {Equus caballus} MARSLKEGATCPICLELFFKPAFLSCMHTFCFDCIGRWMLERDDLKLICPMCRGVNKKLPLLELKVSELTLLVKQHSPLLELSLHVSEEFLRFQEDVTLSTVTANSLLVL
SEDLKNVWCGKICHNRMEDPQRFAHLPCVLGTPSFSSGRHYWEVEVGEGKEWALGVCKESVDRKRKSGFSSEHGFWIISMKAGAIYASSIPQTKIPASSGLSRVGIFLDV
EMEEIKFFDVRNDALIYIHSPFTCLEPLCPFFRPELPGESDHGAPLSICP*
46 >lcl|XP_001503041.1|Plus1complement(31824100..31826244) NW_001867405 Bardet-Biedl syndrome 12 protein BBS12 __SEG__ Chr2 {Equus caballus} MVMACRVINKRRHMGLQQLSSFAETGRTFLGPVKSSKFIIDEECHESVLISSTVRLLESLDLTSAVGQLLSEAVRAQNNTYRTGTSTLLFLVGAWSSAAEECLHMGVPVS
LIVSVMSEGLNSCIEEVVSLEVPVHHVFDHIDNTKTFSGLETFSVSLGPFLQIPSDTGLMQKEHDLKDVAPQPLTIHNLSGRPVKSPQLFRPQAKVEADTNTSQTPQTLK
NSLLADTCCRKSVLIHSRHLNRTDNSQQISKPDGFLEQHGAATPQAYRCNDLVELEVGLSHGDDSSMKLVEAAAQLQYQNARTQQGSCAMPFMFDISRIFTCCLPGLPES
FSCVCPGYITVVSTSSTTLIKELQNQPIRVVLIEGDLTENYRHLGFNKSANIKTVLESMKLPQDSSEELWINRVLEILIKFNVNLILAQGNVSEHLIEKCTHSKRLVIGS
VNGNVMQAFAEASGAVQLAYITQVDENCVGNGVCVTFWRSIPLDVVDTVDGMAIMLKTEGINLVTVVLTSPVTAHMQSKEDRFWTCASRLCYALKEQKVFLGGGAVEFLC
LSHLQILAEQSLSKGNQACSGWLHNTSSWLASSLALYRPTVLQCLANGWHKYLSTLIYNTANYSSEFEASTFIQHHLQNAIDSGSPSSYILSEYSKLNSGIFNSGISNKL
GQIPRVYDIVTPKIEAWRRALDLVLLVLQTDSEIITGLGHTEINSQVPEGFLFL*
47 >lcl|XP_001503136.1|Plus11165646..1165960 NW_001877046 WW domain-binding protein 5-like LOC100059264 __SEG__ ChrX {Equus caballus} MKPCQKIEGRPENESEPKTEEEPKPEEKPEEEEEPEEEEKTEGTFRERLIQSLQEFKEDIHNRHLSKEDMFREVNEIDEIRRVRNKLIVMRWKVNRNHPYPYLM*
48 >lcl|XP_001503255.1|Plus126996605..26997906 NW_001867425 RING finger protein 26-like LOC100071421 __SEG__ Chr7 {Equus caballus} MEAVYLVVNGVGLVLDVLTLVLDLNFLLVSSLLASLAWLLAFIYNLPHTVLTSLLHLGRGVVLSLLALIEALVRFTFGGLQALCTLLYSCCSGLESLKLLGHLASHGALR
SREILHRGVLNVVSNGHALLRQACDICTIAMSLVAYVINSLVNICLIGTQNLFSLVLALWDAVMGPLWRMTDVMAAFLAHISSSAVAMAILLWTPCQLALELLASAARLL
ASFVLVNLTGLVLLACVLAVTVTVLHPDLTLRLATQALSQLHARPSYHRLREDVVRLSRLALGSEAWRRVWSRSLQLASWPNRGGAPGAPHSGPRRVPSATTWRQDILPE
AGPRSVAEEEEVRMARAAAARGRERLNEEMPIAGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRGILQTLNVYL*
49 >lcl|XP_001503282.1|Plus1complement(48221130..48221636) NW_001867385 proteasome subunit beta type-3-like LOC100071832 __SEG__ Chr19 {Equus caballus} MLTTDLQKIFPMGEWLDISLTGLATNFQTTAQHLKFQLNLCELNEGSQIKPYTLMSVMANLLYKKQFGPCYTEPVIAWLDLKTFTPFLCSLDLISCPVVTDDFVVSSTCA
EQMCGMCESLGAHHAHLLETVSQAMLNAVDGDAARCKSHFHLAEEDKTTTRILKAQMD*
50 >lcl|XP_001504108.1|Plus1complement(28779757..28780503) NW_001867402 14-3-3 protein sigma-like LOC100057082 __SEG__ Chr2 {Equus caballus} MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKGNEEGSEEKGPEVQEYREKVETELRGVCDTVLGLLDTHLIKE
AGDAESRVFYLKMKGDYYRYLAEVATGDNKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIM
QLLRDNLTLWTADNAGEEGGEAPEEPQS*
51 >lcl|XP_001504292.1|Plus145820100..45821161 NW_001867364 e3 ubiquitin-protein ligase RNF146 isoform 1 RNF146 __SEG__ Chr10 {Equus caballus} MAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGR
NGWWQYDERTSRELEDAFSKGKKSTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDANTVNLARESSADGADSVSAQSGASVQPLVSSVRP
LTSVDGQLTSPATPSPDANTSLEDSFAHLQLSGDSIAERSHRGEGEEDHESPSSGRVPAADISIEETESDASSDSEDVSALVAQHSLTQQRLLVPNANQTVSDRSGTDRS
VAGGGTVSVRSRRPDGQCTVTEV*
52 >lcl|XP_001504872.1|Plus1complement(50059805..50060434) NW_001867366 RING finger protein 222-like LOC100062634 __SEG__ Chr11 {Equus caballus} MSEGESKDSLGSECPVCYEKFRDLEGASRTLSCGHMFCHDCLVKYLLSTRVDGQVQRTIVCPICRYVTFLSKKSSRWPSMLDKSSQSLAVPMGLPTVPPLDTMGHTNPLA
ISQPVWRPSPSQSAQLPLDLLPSLPREPQIFIISRHGMPLGEQDSVLPRRSVAELSEASPAPSSTRSFCCRSRALLLITLIAVLAVVAAVLPWVLLVRK*
53 >lcl|XP_001504946.1|Plus121088261..21090222 NW_001867396 e3 ubiquitin-protein ligase TRIM32 TRIM32 __SEG__ Chr25 {Equus caballus} MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQ
FCRSCGVVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLARLRELMGELQRRKVALEGVSKDLQARYKAVLQEYGHEERRVQEELARSRKFFTGSLAEVEKSNSQV
IEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAAKKPRTVNMEDSWAMEAAASAASTSVTFREMDLSPE
EVVASPRASPAKQRGSETATNIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLSFLGADLPNLTPLSVAMNCHG
LIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGAGVVKYNCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENRQNEHHLEGGF
SIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP*
54 >lcl|XP_001505024.3|Plus11078927..1079439 NW_001877044 cellular nucleic acid-binding protein-like LOC100060137 __SEG__ ChrX {Equus caballus} MSSKDCFRGGRSGHWARGCPRGGARGRGARGRGRGSQGTSTTLPDICYRCGESGHHARDCHLLENICYNCGRSGHIAKDCTEPKREREQCCYTCGRRGHLARDCDRQEQQ
KCYSCGELGHFQKDCTQVKCYRCGETGHVAINCSKKNKVNCYRCGKPGHLARECPTEATA*
55 >lcl|XP_001914714.1|Plus11445839..1447725 NW_001877041 ubiquilin-2 UBQLN2 __SEG__ ChrX {Equus caballus} MAENGESSGPPRPSRGPASAQGPASAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQG
QSTQPSNAAGTNTTSPSTPRNNSTPLSTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQNQMQQQLLSSPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPE
ISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSA
TTSTTSSSGSGSGSGSGSSSTSATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPVFTANPQLQEQMRPQLPAFLQQ
MQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFAPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAGPPGSTGSGGPPGPTISSSAPSET
TSPISESGPNQQFIQQMVQALAGANPPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS*
56 >lcl|XP_001915247.1|Plus16744566..6745300 NW_001877043 OTU domain-containing protein 6A-like LOC100146692 __SEG__ ChrX {Equus caballus} MEDSQRMVRRHYREKKELQARIQSMKNSVPKSDKERRKQLLLDVARLKAEMEQKHQQELEKFQESFPDDSNLDSVTEDLAKMDLENQPPRLAKAQRRRERRAAEEAARLE
RIAEVEAERQAGFRHDDEEEKLSAILEARNLEMKEIPADGHCMYRAIQDQLVFPVTVESLRRRTANYLRKHVDDFLPFFSDSETGDTCSRDSFLSYCDDIVHSALWGGQL
ELRALSHVLADPHRGDHFLLISSY*
57 >lcl|XP_001917043.1|Plus1complement(692281..694653) NW_001867420 LOW QUALITY PROTEIN: disintegrin and metalloproteinase domain-containing protein 30 ADAM30 __SEG__ Chr5 {Equus caballus} MRSVRTLLSQGRSLSILILVLGLLLVDSLGEDLIFHPEWGFDSYEIIIPKKLSSRGGEEAVAKHVSYLLQVKGKEHVLHLWPKRLLLSRNLQVFSFTEEGDLLEDYPYIP
GDCNYMGFIEGTRDSEATLSTCLGGLQGILKIDAKHYQIEPLKASSSFEHVIYLLKKEEEFHNQSCGLLDDEIKRQMAQHENVARLRDFSDSYKHKKYLELALVFDHRRY
LYSNSNLTRVINDAILMTGIMDTYFQDINMRIHLRGIEVWTDANKMKVDSPTTQQVLSQFLLYRRRTLNARIPADWAHLYLKGQYVDYLGQSFGRVCSQTYSGAISVFPD
INVLGPATWSAHCLGHGVGMSHDYEYCQCKGRRSCIMGTGRTGFSNCSYSYYIAFIHSAGACLTDIPEVGYVVQRCGNKIVEENEECDCGSREDCKKDQCCQPDCKLKHG
VNCSMGLCCHKCHFRPSGYVCRKEENECDLAEYCTGTSGLCPSDTYKQDGTPCKYEARCFRKGCQSRYMQCQRLFGPDAREAPSKCYDAVNLIGDQHGNCGIRGIGDYQK
CTRENAVCGRLQCINVKTIPEMPEHTTIISTHLGEENLMCWGTGYHLSKVPLGIPDIGVVNDGTSCGTNRICVNRTCVDSSLLQFDCLPEKCNHRGICNNKKNCHCLYGW
APPFCEEVGYGGSVDSGPPGPLKARVPTLLQVVLIMLTRISLFAISVIIVYLK*LVENCLKLKQKKTPPINTGVRKSKAKEVKKPKDESGNPQSLNNAGPYIEQACLSTR
LLVLLPILFYLIFLQVLINK*
58 >lcl|XP_001918142.1|Plus1complement(11537497..11538627) NW_001867420 protein arginine N-methyltransferase 6-like LOC100060260 __SEG__ Chr5 {Equus caballus} MSQPKKRKLESGGGGGGGGEGTEEEDGGEREAAVPRPRRTRRERDRLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVY
AVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQMLELRLDFWSQVKQLYDVDM
SCLESFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRFSCYGSAPMHGFAIWFQVTFPGGDSEKPLVLSTSPFHPVTHWKQALLYLNEPV
QVEQDTAISGEITLLPSRDNHRLLRVLLRYKVGDQEEKTKDFAMED*
59 >lcl|XP_001918357.1|Plus194213935..94214834 NW_001867387 proteasome subunit beta type-11-like LOC100055985 __SEG__ Chr1 {Equus caballus} MALQDVCKWQAPDTQGLSPHLPQAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGNYVACPASRKVIPVHQHLLSTTSGTSADCATWYRVLQR
ELRLRALREGQLPSVASAAKLLSAMMSHYRGLDLCVATALCGWDRSGPALFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMTTQEAYALARCAVAHATHRDAYSG
GSVDLFHVRESGWEYVSRNDAWVLYSELQKLPEPEKEEEEEASQAHPEPATPTELAKVQNSPRGLEPGDSRMPAETETL*
60 >lcl|XP_003363124.1|Plus163826877..63827164 NW_001867381 small ubiquitin-related modifier 2-like LOC100049890 __SEG__ Chr16 {Equus caballus} MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY*
61 >lcl|XP_003363315.1|Plus1complement(43870774..43873029) NW_001867384 LOW QUALITY PROTEIN: fidgetin FIGN __SEG__ Chr18 {Equus caballus} LEDAVDAGACPVARTAL*HHLNHAVSCPQSGSLQRSFAAHLSVRLGER*HICADCIQPTKKICREVFWHFGRPCGPTCTQQLFRCTIRTSERSEK*KRTLAAFLEFRSCL
SYELCSGCYHCQQSWSQFSPPSSRCLCKYRELSWGGQQPDRT*LFK*YLWKPHCT*SSCRAPVSGICPRIQRLISAFYLQ*SASTCTSFTSSIPFA*LWAPPAATTTSSA
TSPGPRLQWDF*PLQLQLSLC*LSSSDCCGIWVQPWGGTPSSFSIPAFRNSCSYPPAPHHCSWLHLPGSWFDTYCTLGSDQQFSKFSQKGKLSIWQGKEIWDSSYGNYSY
GQQRSTQSPMYRMPDNSISNSNRGNGFDRSAETSSLAFKPTKQLMSSEQQRKFSSQSSRALTPPSYSTAKNSLGSRSSESFGKYTSPVMSEHGDEHRQLLSHPMQGPGLR
AATSSNHSVDEQLKNTDTHLIDLVTNEIITQGPPVDWNDIAGLDLVKAVIKEEVLWPVLRSDAFSGLTALPRSILLFGPRGTGKTLLGRCIASQLGATFFKIASSGLVAK
WLGEAEKIIHASFLVARCRQPSVIFVSDIDMLLSSQVSEEHSPVSRMRTEFLMQLDTVLTSAEDQIVVICATSKPEEIDESLRRYFMKRLLIPLPDSTARHQIIVQLLSQ
HNYCLNDKEFALLVQRTEGFSGLDVAHLCQEAAVGPLHAMPATDLSAIMPSQLRPVTYQDFENAFCKIQPSISQKELDMYVEWNKMFGCSQ*
62 >lcl|XP_003363562.1|Plus1complement(77473089..77473655) NW_001867387 e3 ubiquitin ligase RNF4-like LOC100630319 __SEG__ Chr1 {Equus caballus} MNTRMGYGSMVNSRQAREFHTAGERGPTPQTVLEAELIELGESDEVVDLTCESLEPAVIDLTHQDCVVITEERRRPRGNTRSLQGQTGSCVVSSDKELMRDRDVYVTHSA
YHNALEEETLSCTLPGYIQCRICMDGYSEIELSRRHIYSTDCGHIFCSQCLCTSLKYTKTCPVCLKKIGCRQYHRIYL*
63 >lcl|XP_003363861.1|Plus131564656..31566581 NW_001867389 heat shock 70 kDa protein 1 HSPA1A __SEG__ Chr20 {Equus caballus} MAKSTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVINDGDKPKVQVSYKGE
TKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVK
ATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ
IHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLI
QVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK
SAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIITGLYQGAGGPGAGGFGAQAPKGGSGSGPTIEEVD*
64 >lcl|XP_003364062.1|Plus1complement(16443885..16444871) NW_001867395 disintegrin and metalloproteinase domain-containing protein 21-like LOC100629876 __SEG__ Chr24 {Equus caballus} MEEPDHSASRSFPLDRWLHNGSSIMVASEAEVSMRVVLLLLWHGLSLFPTDLSQAGSSQHLSILEVVIPLKVTNRGRGAKTPVCLSYSLQFGGWRHIVHMKAKELLVSRH
LPVFTYMDQHALQQDQPFVPDDCYYHGYVEGVPESLVALSTCCGGFRGTLHINDLTYEIEPIRHSTTFEHVVYTVNTNETQFPSMRCGLTKKQIAHQQLEFEKAEKSTLK
QNSTDNWWTHSWFLELAVVIDHNFFIYSQSNFSKVQEDVFLVVNIVDSIYQQLGTYVILIGTEIWNHGNVFPMVNIEQSTPWEAVWYKWPLSPGGEEKSQPRKNHRYR*
65 >lcl|XP_003364161.1|Plus138774866..38775396 NW_001867396 hypothetical protein LOC100629886 LOC100629886 __SEG__ Chr25 {Equus caballus} MRGCHRGSGVAAAPLLTSPRMLQPEGPQASEEGTAAGTRRGDCIICYSAYDLTGHLPRRLYCGHTFCQACVRRLDTRTNEQRWIPCPQCRQSTPTPRGGVAMLDLDLATF
LAVKAEREPSHMEPQPPAPLKGSTAITQQPARLCPTLGPQPDFPQPRCCCWGCGNLCWEPPGSPEV*
66 >lcl|XP_003364350.1|Plus1complement(37442141..37443079) NW_001867399 dnaJ homolog subfamily B member 7-like LOC100629166 __SEG__ Chr28 {Equus caballus} MVDYYEVLGVQRYASPEDIKKAYCKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDKKRDTYDKYGKEGLNGRVRSHFDDSFEYGFTFRKPDDVFKEIFGERDPFSF
HFFEDSLEDLLNGPRSCYGSRNRGGRCVFSPSSEYSIFERFSSCDTGYTPYGSLGHEGLNSFSSLAFDDSGMGNYVSVTTSGKIVNGRNTNTKRIIENDQEREEIEDNGE
LKSFLMKSVTGEEGFVEECSWRRQSFNKYSPKSHSPEHVCQYTFVDNDEQAIPWVTSNWDPLIFSAGFKEGGKRKKKKHKEVQKKKSTKRNR*
67 >lcl|XP_003365186.1|Plus1complement(13067656..13068378) NW_001867422 dnaJ homolog subfamily B member 3-like LOC100146238 __SEG__ Chr6 {Equus caballus} MVDYYEVLGVPRQASSEVIKKAYRKLALKWHPDKNPENKEEAERRFKQVAQAYEVLSDAKKRDVYDRYGEAGVDEGGGRGGLFEDPFEYVFTFRDPAEVFREFFGGQDPF
SFDFFGDPLENIFGGRRNAQGSRSRGSTNLFSSFSEFPMFGGAFSSFDAGFPSFGSLGNGGLSSFSMSCGSGGAGNFTSLSTSTEIVNGKKITTKRIIENGQERVEVEED
GELKSLVINGKEQLLHIATK*
68 >lcl|XP_003365551.1|Plus1complement(7272904..7275393) NW_001867429 disintegrin and metalloproteinase domain-containing protein 1a-like LOC100057424 __SEG__ Chr8 {Equus caballus} MSVAASVRDSASFLSSLQKNQAVMYEASRVLQTWAPQMKGFRLALVPGPSRVRLGIMLVLALIFLPRLYCDLGAVYYSSYETVIPKSLTVNGREGPVEKASYMLLMQGQK
QLLHLKVKRDYFVDNFPIFSYHNGILGQEMPVLAHDCHYEGYIEGVPGSFVSVNTCSGLRGVLIKEGKSYGIEPVGASKKFEHVLYTMAREARISCSVTSKDSQVVSTSQ
QRGSRKPRSAQALSYLWSHTKYVEMFVVVSNQRFQMWGSNINETVQRVMDVIALANAFTRGINTEVVLAGMEIWTEGDLIEVPADLQVTLRNFNSWRQDKLFHRVKHDVA
HMILGHRPQEDTGQAFLNGACSTGFAAAVESFHHEDVLLFAALMVHELGHNLGIQHDHSACVCKDTHFCLMHENITKESGFSNCSSDDFYQFLLDHKGACLFNKPQHKGR
VRRDAECGNGVVEEDEQCDCGSACDNHPCCDPACKLKEGAECSDGLCCLNCRLRKSGSTCRSAFDDCDLPEYCDGNSAECPTDSYKQDGTSCDLIHYCLGGRCRNPDTQC
IDIYGYPAKSAPSDCYNLFNRKGTRFGNCGPPTLNNPEYVKCADDNLYCGKIICTNIRQLPPIKPLHTLIQVPFEDDFCWSMDATNGTADIPDDGDVFAGTLCSSGKVCM
GHSCSPDTVLNYDCNPEEMCAGKGICNNLKHCHCNFGYAPPNCTTPGNGGSLDSGPPGLPSAEEPQSQSTTSPPKGAGLLLDMMVLIFLILLLILLLMLIICGIYCCLGA
KEEEKPAEEAAEKPPEEAAEKPPEAEPKEAGSEAPSEEEEEEEEEEEEEEEEEEEESEP*