SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam O    

ID / Description / Sequence
1 >lcl|NP_001003067.1|Plus11288106..1290031 NW_876254 heat shock 70 kDa protein 1 HSP70 __SEG__ Chr12 {Canis lupus familiaris} MAKSAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVVNDGDKPKVQVSYKGE
TKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVK
ATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ
IHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLI
QVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRDRVSAKNALESYAFNMK
SAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIITGLYQGAGGPGAGGFGAQAPKGGSGSGPTIEEVD*
2 >lcl|NP_001003115.1|Plus140696237..40697238 NW_879562 cathepsin L1 precursor CTSL2 __SEG__ ChrX {Canis lupus familiaris} MGPAWAQAHLTGNLWLPLLWLLLSPGCCSRALPGWRFTSSEVVIPRKVSHRVGGMERQGHLSYKIHFRGQRHVVHMKVKKNLLPRHFPVITDNDQGAMQEDYPFVPRDCY
YYSYLEGVPGSMGTLDTCNGGLRGMLQVDDFTYEIKPLEASSTFEHVVSLLVTEGRSSEAQKCKIGEQDTDQAYEEAMLAGTPRAGPVYLWQSHRKFLKIHYTISHSLYL
MRPNITQAIEGVVMINSILHTIYQQSLINVYIRLLCIWNDRDHVEITKKKSAYSAVEDFGLWKYYGFFYKIEHDTSLLLTGHKIVGSIYFAHHGGTCNPNWGAMFVYVAN
YHIFLAGGISAHTLGHSLNLVHDVFGCKCFRRSHCVMTEQPGLMDMLSNCSYDSLHRRVSGWDPCMSIPNVPYTNFPYVAPRCGDKIRNQLEECDCGSLKDCNDNKCCET
NCAFSLGSDCSEGSCCVNCKYAQPGLLCRDILGICDLPEYCDGTSHNCPNDVYTQDGTPCSTLAVCVRGNCTDRDMQCQSLFGYGIKDAAPACYEKLNVLGDRFGNCGVR
VVRGGGKPVRCEEDDVLCGMLHCRDVEEIPGGGDHVTFRHIIVTGINQEKCFGYDAHHGTEIPEMGLVVDGATCGPGKYCLNQNCTFYQDMGFDCDVSTCNFRGVCNSKK
HCHCMRGWKPPTCEEKGAGGSIDSGPPPDREYVLRGKVTVSVNRALGLIVIRTLLFLTGLIIGLFFQLKKRY*
3 >lcl|NP_001006650.1|Plus1complement(16939699..>16940841) NW_876302 NHL repeat-containing protein 1 NHLRC1 __SEG__ Chr35 {Canis lupus familiaris} VREAEVSLLECKVCFERFGHRQQRRPRNLPCGHVVCLACVAALAHPRTLALECPFCRRACRGCDTSDCLPVLHLLELLGSALRPAPAAPRAAPRAPGALACHHAFGGWGT
LVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGEAAQDIRYPLDVAVTNDCHVVVTDAGDRSIKVFDFFGQIKLVIGDQFSLPWGVETTPQNGVVVTDAE
AGSLHLLEVDFAEGALQRTEKLQGHLCSPRGVAVSWLTGAIAVLEHPPGLGAGAGSTAVKVFSPTMQLIGQVDTFGLSLFFPSRITASAVTFDHQGNVIVADTSSQAVLC
LGQPEEFPVLKPIITHGLSHPVALTFTKENSLLVLDSAAHSVKVYKADWG*
4 >lcl|XP_003431570.1|Plus1complement(25047214..25047672) NW_876251 ubiquitin-conjugating enzyme E2 N-like LOC100683539 __SEG__ Chr10 {Canis lupus familiaris} MARLPRRIIKETQRLLAEPAPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFITKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQA
LLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLNAMNNI*
5 >lcl|XP_003431601.1|Plus1225810..226118 NW_876252 10 kDa heat shock protein, mitochondrial-like LOC100687092 __SEG__ Chr11 {Canis lupus familiaris} MAGQAFRKFLPLFDWVLVERSAAETVTKGGIMLPEKSQGKVSQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD*
6 >lcl|XP_003431705.1|Plus1complement(49766880..>49767470) NW_876254 dnaJ homolog subfamily B member 6-like LOC100684448 __SEG__ Chr12 {Canis lupus familiaris} FCQIAEAYEVLSDAKKRDIYDRYGKEGLNGGGGGGLHFDTPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGSRRGPRGGRNQGTGSFFSAFGGFPSFGGGFS
SFDTGFTSFASPGHGGLTSFSSTTFGGSGMGKFKSISTSTKMVNGRKITTKRIVEKGEERVEVEENGQLKSLTINGKEQLLRLDNK*
7 >lcl|XP_003431757.1|Plus1complement(4084555..4084884) NW_876254 peptidyl-prolyl cis-trans isomerase FKBP1A FKBP1A __SEG__ Chr12 {Canis lupus familiaris} MGVVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLVFDVELLKLE*
8 >lcl|XP_003431804.1|Plus133289762..33290049 NW_876254 small ubiquitin-related modifier 2-like LOC100684310 __SEG__ Chr12 {Canis lupus familiaris} MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY*
9 >lcl|XP_003431949.1|Plus1complement(26483333..26483674) NW_876258 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1-like LOC100683731 __SEG__ Chr14 {Canis lupus familiaris} MSTLVVWVILRFLEEYLSSTPQRLKLLDTYLLYILLTGALHFGYCLPVGTFPFNSFVSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMN
FVG*
10 >lcl|XP_003432131.1|Plus1complement(16793363..16794136) NW_876260 thioredoxin-dependent peroxide reductase, mitochondrial-like LOC611135 __SEG__ Chr16 {Canis lupus familiaris} MTAAVGRLLWASIARHVSAIPWGISASAALRPAASRRTCLTNVLWSGSSQAKFAFSTSSSYHAPAVTQHAPYFKGTAIVNGEFKDLTLDDFKGRYLVLFFYPLDFTFVCP
TEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINTPQKNGSLGHMNIALLSDLTKQIPRDYGMLLEGPGIALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLCLVKAF
QFVETHGEVCPANWTPDSPTIKPHTTASKEYFEKVNQ*
11 >lcl|XP_003432263.1|Plus1complement(48646824..48647312) NW_876263 S-phase kinase-associated protein 1-like LOC100688168 __SEG__ Chr17 {Canis lupus familiaris} MPSIMLQSFDGEIFEVDVEIAKQSVTIKTMLEDLGMDYEGDDDPVPLPNVNAAILRKVIQWCTHHKDDAPPEDDENKEKCTDDIPVWDQEFLKVDQGTLFELILAVNYLD
IKGLLDVTCKTVANMIKGKTPEEIHKTFNIKNDFTEEEEAEVCKENQWCEEK*
12 >lcl|XP_003432316.1|Plus1complement(11619219..11619587) NW_876264 prefoldin subunit 1-like LOC483223 __SEG__ Chr17 {Canis lupus familiaris} MAAPVDLGLNKAFTELQATVIDTQQKVKLADIQIEQLNRTKKRARLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAED
NIREVLMARRAQ*
13 >lcl|XP_003432352.1|Plus1complement(2972473..2972958) NW_876265 peptidyl-prolyl cis-trans isomerase-like 3-like LOC483236 __SEG__ Chr18 {Canis lupus familiaris} MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPH
LDMKYTVFGKVIDGLETLDELEKLPVNEKTYWPLNDVHIKDKTIHANPFAQ*
14 >lcl|XP_003432513.1|Plus1complement(17547031..17549172) NW_876267 Bardet-Biedl syndrome 12 protein-like LOC100686286 __SEG__ Chr19 {Canis lupus familiaris} MVMACRVINKRRHMGLQQLSSFAGTGRTFLGPVKSSKFIIDEECHESVLISSTIRLLESLDLTSAVGQLLNEAVQAQNNTYKTGTSTLLFLVGAWSSAAEECLHLGVPIS
VIVSVMSEGLNSCIKEVVSLQVPIYNVFDHLDSTKTFSGLETFNISLCPFLQIPSDTGLQKEHDLNDVASPSLTTYSLSGIPVKSPKLFRRQTEVEADKNTLQNPQTLKN
SLLASSHYRKSILIHSRHFNRTANNQWINKPDGFLEQHGAATPNTYRCNDLVELEMGLSHGDHNSMKLVDEAVRLQYQNASIQQGNCTMPFRFDISRIFTCCLPGVPETF
SCVCPGFITVVSISNTTLIKELENQPVRVILIEGDLTENYRHLGFNKATNINTLLESMKIQQNSSEEVWTNYVLQVLIKFNVNLVLVQGNVSEHLIERCIHSKRLVIGSV
NSTVMQAFAEASGAVQVTYITQVNENCVGNGIYVAFWRSIPSDVIDRINVITIVIKTEGINLVTVVLTSPVTAQMQTKEDRFWTCAYRLYHALREQKVFLGGGAVEFLCL
SHLQILAGQSLSKRNHVCSGWLHNTSSWLASSLALYRPTVLNCLANGWHRYLSTLMYNTACCSSEFEASTFIQQHLQNARDSGSPSSYILNEYSKLNSGIFNPSISNKLE
QIPSIYDIIIPKIEAWRRALDLVLLVLQTDSEIITGLGHTQLNSHETEGFLFL*
15 >lcl|XP_003432547.1|Plus114995095..14995706 NW_876269 E3 ubiquitin-protein ligase RNF152 RNF152 __SEG__ Chr1 {Canis lupus familiaris} METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKLPPGFSVSQLPDDPEVLAVIAIPHASEHTPVFIKLPSNGCYMLPLPIAKER
ALLPGDLGCRLLPGSQQKPVTVVTIPGEQQPLQGGPPQEAAEEEPDRRGAAKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG*
16 >lcl|XP_003432584.1|Plus1complement(37108627..37109055) NW_876269 proteasome maturation protein-like LOC100688243 __SEG__ Chr1 {Canis lupus familiaris} MDARGLGSQLKDSIPVTELSASGPFEQHDLLGKGLPGVKNVLFLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLNLQMEFKAVRQVQHLPFLPSSNLSLDILRGND
ETIGFEDILNDPSQSELMGEPHLMVEYKLGLL*
17 >lcl|XP_003432997.1|Plus1complement(16374066..16374539) NW_876273 peptidyl-prolyl cis-trans isomerase A-like LOC100685760 __SEG__ Chr21 {Canis lupus familiaris} MVNPSVFFDIALVREPLGCVSFKLFADKIPKTAENFNALSSGETRVGSKSSCFRGISLGFMCQARIFTRYYGTGWKSIYGEKFDDENFILKHMGPGILSMANAGPNKNSP
QLFLCVANTGPLDGNVWSLAKERGHEYCAGHGALWVQEPQDQQDHHC*
18 >lcl|XP_003433006.1|Plus1complement(27259160..27260764) NW_876273 ubiquitin carboxyl-terminal hydrolase 17-like LOC100684395 __SEG__ Chr21 {Canis lupus familiaris} MEAAYLHRSEASQFNDSPKPQSCWSKRGGAEVHGGPSLPEKTSPASKTLSSLTDPLAPASAGRPPTKTPLSWEDLSQVGAGLQNMGNTCYVNATLQCLTYTEPLASYVLS
QKHGTACRKQTSCMLCTLQAHMTRVLCHPGRVLRPLPLLLAAFHTHKQEDAHEYLMFILDAMQQACLPEDKPSDSQHAQDSTLIQHIFGGYWRSQIQCLHCQSISSTLEP
YLDIRLDIGAAQSVSQALEQLVKPEMLEGENAYHCSKCLEKVPASKVLTLHSCAKVLILVLKRFSDFTGNKMTKEMQYPECLDMQHSLSEQRAGPLVYVLYAVLVHAGWS
CHSGRYFCFVKAGNGQWHKMDDAKVSACVVTCALRQLAYVLFYMQKTDMERDLVSGSVEGGIASPEADPAEVGEASGESTRDPTVNLAESEEHGEETSRQQTTLDQGRCL
QECNRPKPELHVRRREIALPENAVILQHSKYRHEMPKNHPQQTMDLLHTAAGMIPPQVAGDVAKVPHVPGRARPTKRTSKKGQRSGEAVQGWVY*
19 >lcl|XP_003433008.1|Plus127315823..27317424 NW_876273 ubiquitin carboxyl-terminal hydrolase 17-like LOC100684614 __SEG__ Chr21 {Canis lupus familiaris} MEAAYLHRSEASQFNDSPKPQSCWSKRGGAEVHGGPSLPEKTSPASKTLSSLTDPLAPASAGRPPTKTPLSWEDLSQVGAGLQNMGNTCYVNATLQCLTYTEPLASYVLS
QKHGTACRKQTSCTLCTLQAHMTRVLCHPGRVLRPLPLLLAAFHTHKQEDAHEYLMFILDAMQQACLPEDKPSDSQHAQDSTLIQRSFGGYWRSQIQCLHCQSISSTLEP
YLDISLDIGAAQSVRQALEQLVKPEMLEGENAYHCSKCLEKVPASKVLTWHSCAKVLILVLKRFSDFTGNKMTKEMQYPECLDMQHSLSEQRAGPLVYVLYAVLVHAGWS
CHSGRYFCFVKAGNGQWHKMDDAKVSACVVTCALRQLAYVLFYMQKTDMERDLVSGSVERGIASPEADPAEVGEASGESTRDPTVNLAESEEHGEETSRQQTTLDQGRCL
QERNRPKPELHVRREIALPENAVILQHSKYRHEMPKNHPQQTMDLLHTAAGMIPPQVAGDVAKVPHVPGRARPTKRTSKKGQRSGEAVQGCVY*
20 >lcl|XP_003433072.1|Plus128631463..28633307 NW_876273 ubiquilin-like protein-like LOC485274 __SEG__ Chr21 {Canis lupus familiaris} MPHVISRTPKMAQSGHSSGMPADKNISSSVTRVIVKTAGKQEDFMIADDTSVRQFKEKLSTHFKCQMDQLVLVFMGRLLKDHDTLSQRGILDGHTIHLVIKSKRSSRSLA
HSSRNLSTKEPCHQVRNTEGNTNGVYQPAGVSHTPLESALLVEPDAPKVHSQDLEVSGPEYIAQMLQNPSIQQLLSNTDLVRQFISEHPDMQQLMQQSPEVSYILDNSDI
LWQTLELARNLAMIQEIMQIQQPEQILEHPLNPQSHLGLETLPGGDNALGQSYVDCNDQMLNSSQDLFGGNPFPALLEGQVLQQLQSSPPSPPPPQERQDQLPQLPTTRV
IYTSSHGLSSITSASVTPNKVNHTPSTHTTTISTKGPSPTCPIQQPARVPALPSIELTQQPQTEDIDATISLDSSDQKLEDDLQPSDEQTKSQITGSMMQLLLNNPYLAA
QMMLFISMPQLSEQYRQQLPTFLQQTQLSDMLIALANPKASQAILQIEQGLQLLATEAPVLLPWVAPYLWGLGWLPAPSCSHPDTVPWAWDVPDIAEPKGPECCHKSGTG
LQSLQSLAGDPSHLLQAPEIRFSQQMESLQAMGFGNHHANLQALIATEGDTSAAIRKLKRSHGF*
21 >lcl|XP_003433073.1|Plus128637683..28639650 NW_876273 ubiquilin-3 UBQLN3 __SEG__ Chr21 {Canis lupus familiaris} MAKSGEALPQGNPAPIQDPRLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLILIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTMGTECPAASVPAP
ASSPGSFPQSSSIYPADMPPTFSLGVLTGLNGLGLTSSSFPDQPSSLMWQHVSMPEFVAQIIDDPFIQGLLSNTGLMRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQT
LEFLRNPAMMQEMMRSQDRALSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFATATTVNATSSSNQPSRTENCDPLPNPWASTYGSSGGRRGRHPGDQDAPETR
NRVPNILGNIGLYDYLQQLHETPQSLGTYLQGIASTLNPSQEPPPPGNRIPPTSSSSQECESGQPLPKESATIKGKSSCPSFLRYPPESNTDQYGSQSGAGNGSTSHSTN
MPDLVLGLGHSANRAPFVPSPLSSVAATLGSPEHAWLPPPAFPRSLRPTSMSQVPQLQDEMRRQLPLLLHLQAAMANPRAMHALLQIEQGLQVLATEAPRLLLWFMPCLA
GLGNMAGSTEPREGALMPEDPPLAPAPEVPPAQGSVELGLHSTPFLQMLQALVGANPQQLQPEIHFRVQLEQLRAMGFLNPEANLQALIATGGDVDAAVEKLRQA*
22 >lcl|XP_003433087.1|Plus1complement(16596910..16597527) NW_876274 ubiquitin-conjugating enzyme E2 E2 UBE2E2 __SEG__ Chr22 {Canis lupus familiaris} MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGEAFFLDITFS
PDYPFKPPKVTFRTRIYHCNINSQDVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYITNRAEHDQMARQWTKQYATYGPAA*
23 >lcl|XP_003433156.1|Plus1complement(7968272..7968730) NW_876276 ubiquitin-conjugating enzyme E2 N-like LOC607817 __SEG__ Chr23 {Canis lupus familiaris} MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQGSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQICTVLLSIQA
LLSAPNPDDPLANDVAEQWKTNETQAIETARAWTRLYAMNNI*
24 >lcl|XP_003433194.1|Plus1complement(33413015..33413473) NW_876276 ubiquitin-conjugating enzyme E2 N UBE2N __SEG__ Chr23 {Canis lupus familiaris} MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQA
LLSAPTPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI*
25 >lcl|XP_003433207.1|Plus1complement(41880073..41880507) NW_876276 ubiquitin-conjugating enzyme E2 N-like LOC609637 __SEG__ Chr23 {Canis lupus familiaris} MARLPHRIIEETQRLLAEPDESNPRYFHVVITGPQDSPFEGGTFKLEPFLPEEYPMVTPKVRFMTKIYHPNVDMLGRICLDILEGKWSPALQIHTVLLSIQALLSAPNPD
DPLANDVAEQWKTNKAQAIETARAWTRLYAMNNI*
26 >lcl|XP_003433402.1|Plus1complement(26569714..26570430) NW_876279 dnaJ homolog subfamily B member 3-like LOC610356 __SEG__ Chr25 {Canis lupus familiaris} MVDYYEVLGVPRRASAEAIKKAYRKLALRWHPDKNPENKEEAERRFKQVAQAYEVLSDARKRDVYDRYGEAGVEGGGGSGPCHDPFEYVFTFRDPAEVFREFFGGQDPFS
AFDFFGDPLESVVGGRRSSRGGGGGRGTVPFFSAFSEFPAFGGGFSSLDTGFSSLGNGGLSSFSMSYGSGGTGNFKSVSTSTEIVNGKKITTKRTVENGQERVEVEEDGE
LKSLVINGKEQLLRLDTK*
27 >lcl|XP_003433462.1|Plus19441260..9444007 NW_876282 disintegrin and metalloproteinase domain-containing protein 1-like LOC100683375 __SEG__ Chr26 {Canis lupus familiaris} MAISMAVSLRHSASILPSLWKNQGALKEGKIKFQTWAQQKRDFRLGPVPQLSSVRLGILLLLVLIFLPSLYCDPGSVYYSSYETVIPKSLTAKGREDPGEKASYVLLMQG
QKQVIHLKVKRDYFVSNFPVFSYHNGVLGQEMPFISHDCHYEGYIEGVPGSFVSLNTCSGLRGILIREGKPYGIEPMDTSKRFEHVLYTMAHQARVSCNVTSKGSQVVST
SRQQGSREPRSLQAPSSFWSHTKYVEMFVVVNHQRFQMWGSNVNETVQRVMDITALANIFTRGINTEVVLAGMEIWTEGDLIEVPADLRVTLRNFNSWRQEKLFHRVEHD
VAHMIVGHHPEGDAGQAFLNGACSGGFATAVESFHHEDVLLFAALMVHELGHNLGIQHDHSACICKDKHFCLMHENITKESGFSNCSSDYFYKFLREHKGACLFNKPRPK
GRLRRQATCGNGVLEEDEQCDCGPDCGNNLCCDQTCRLKEQAQCNDGLCCFNCQFRHKGFMCRSALGECDLPEYCDGSSGKCPTDLYKQDGTLCDIIHYCFRGRCKNPDI
QCMDIYGSPAVSAPEDCYISMNSKGNRFGNCGFGASPRSKYVKCFDENIFCGKLVCTNIRRIPVIKPYHTLIQVPYEKDFCWSMDAYNISDIPDDGDVHTGTLCAPHKVC
MNYSCTDHVVLKYDCEPKEMCNGRGVCNNLKHCHCEAGYAPPDCKAPGNGGSVDSGPPSKSPNNENLSAGGIAIPTKRTSEMKILGKVIFILPAFLLLLLLILIFFISLR
AGIESIETPGGSSEVTSETTTTTEATEFLTQDLGKNVANVSEMGPEKEPQEAQPPEEPSPPQEELFPQEVPPPQEAPQPQDAPKPQKTPKPKEASPPEASATLDTPPPDA
PPPPDSPLPPDTSPPPDIPPPPKAPLPEVPGEPVP*
28 >lcl|XP_003433640.1|Plus1complement(1156408..1158381) NW_876285 N-acetylgalactosaminyltransferase 7-like LOC100686492 __SEG__ Chr28 {Canis lupus familiaris} MRLKIGFLLRSLLVLGSFLGLVLLWSSLSPRPDDPSPLSRMREDRDVNNPMPNRGGDGLAPGDDRFKPVVPWPHVEGVEVDLESIRRKNKAKNEQERHAGGDNQKDIMQR
QYLTFKPQTFTYRDPVLRPGILGNFEPKEPEPHGVVGGPGENAKPLVLGPEFKHAIQASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGW
STLMRTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDDYIKLWNGLVKVFRNERREGLIQARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRTICTVPII
DVINGNTYEIIPQGGGDEDGYARGAWDWSMLWKRVPLTPREKRMRKTKTEPYRSPAMAGGLFAIERDFFFELGLYDPGLQIWGGENFEISYKIWQCGGKLLFVPCSRVGH
IYRLEGWQGNPPPIYVGSSPTLKNYVRVVEVWWDEYKDYFYASRPESKALPYGDISELKKFREDHNCKSFKWFMEEIAYDITSHYPLPPKNVEWGEIRGLETVYCIDSMG
KTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGPDGSKIMITHCNLNEFKEWQYFKSLHRFTHIPSGKCLDRSDVLHQVFISNCDSSKMTQKWEMNNIHSV*
29 >lcl|XP_003433666.1|Plus116268150..16268941 NW_876285 proteasome subunit alpha type-1-like LOC100683135 __SEG__ Chr28 {Canis lupus familiaris} MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVS
LIGSKTQIPIQRYGRRPYGVGLLIAGYDDRGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSGLMECNLNELVKHGLCALGETLPAEQDLTTKNVSIGIVGKDLE
FTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH*
30 >lcl|XP_003433744.1|Plus1380740..381207 NW_876289 ubiquitin-conjugating enzyme E2 B-like LOC100683210 __SEG__ Chr2 {Canis lupus familiaris} MSTPPPTQKRLMWDLKQLQEDPSVGVSGAPSENNIMQWNTVIFGPEGTPFGDGTFKLVIEFSEEYPNKPPTVRLSSKMFHPNVYADGSICLDILQNPWSPTYDVFSILTS
IQSLLDEPNPNSPASSQAAQLHQENKREYEKRVSAVVEQSWNDSR*
31 >lcl|XP_003433772.1|Plus11393449..1393970 NW_876291 S-phase kinase-associated protein 1-like LOC477992 __SEG__ Chr2 {Canis lupus familiaris} MPSIKLQSSDGEIFEVDIEIAKQSVTIKTMLEDLGMNDEGDDDPVPLSNVNAAILKKIIQWYTHHKDDSPPPEDDENKEKRADDIPVWDQEFLKVDQGTLVELILAANYL
DIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVHKENQWCEEKLDVMPDTVTL*
32 >lcl|XP_003433773.1|Plus1complement(2085044..>2085334) NW_876291 peptidyl-prolyl cis-trans isomerase A-like LOC100688474 __SEG__ Chr2 {Canis lupus familiaris} WHNGTGGKSIYREKFDDENLILKHKGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNSKTSKKITIAYCGQI*
33 >lcl|XP_003433901.1|Plus1complement(38643694..38644440) NW_876292 14-3-3 protein sigma SFN __SEG__ Chr2 {Canis lupus familiaris} MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKGNEESSEEKGPEVREYREKVETELRGVCDTVLGLLDSHLIKE
AGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIM
QLLRDNLTLWTADNAGEEGGEAPEEPQS*
34 >lcl|XP_003433946.1|Plus111347385..11347954 NW_876294 E3 ubiquitin ligase RNF4-like LOC100685394 __SEG__ Chr30 {Canis lupus familiaris} MNTRMCYGSMVSSRQTREFGTAGEGGPSPEMVLEAELIDLRESDEIVDLTCESLEPTVIDLTCHDSVVITEERRRRGGNTRSFQGQTGSSVVSSDKEELMRNRDVYVTDS
TCHNALEEEAVSCTLPGYIRCRICMDGYSEIELSRRHIYSTECGHIFCSRCLCMSLKYNKNCPVCLKKINCYQYHRIFV*
35 >lcl|XP_003433966.1|Plus123210777..23211181 NW_876294 prefoldin subunit 4-like LOC610170 __SEG__ Chr30 {Canis lupus familiaris} MAATMKKAAAEDVNVTFEHQQKINKFAQNTSRITELKEEIEIKKKQLQNLEDACEDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALEARVESIQR
VLVDLKVQLYAKFGSNINLEADDS*
36 >lcl|XP_003434001.1|Plus124118707..24119375 NW_876295 glutathione S-transferase A4-like GSTA4 __SEG__ Chr31 {Canis lupus familiaris} MAVKPKLHYPNGRGRMESIRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVETDGMKLVQTRSILHYIADKHHLFGRDLKERTLIDMYVEGMLDLLELIIMHP
FLKPDDQQKEVVNMAQKAIIRYFPVFEKVLRDHGQRFLVGNQLSLADIILLQTILALEEKIPNILSAFPHLQEFTVKISNIPTIKKFLEPGSKKKPPPDDIYVRTVYNIF
MP*
37 >lcl|XP_003434013.1|Plus1complement(28132411..28133592) NW_876295 dnaJ homolog subfamily C member 28-like LOC100688021 __SEG__ Chr31 {Canis lupus familiaris} MNTMYVTTAQILRSHLINVSMISNRMKMLPYLGVIRNRMMSTHKSKKKMREYYRLLNLDEGCSADDVRESFHKLAKQYHPDGDSSTADSATFIRIEEAYRKVLSHVVGQT
NARQNKVEEAEEEEDKFKYKTPQHRHYLSFEGIGFGTPSQREKQYRQFRADRATEQVMEYQKQKLQSQYFANSVIVKDVRQSKEQKITQAIDRLVEDLIQESMAKGDFDN
LSGKGKPLKKFSGCSYIDPMTHNLNRILIDNGYQPEWILMQKEIKDTIDQLREAILASRKKLGNPMTLNEQKQWNQVCDQFQEDIRKLNKRINDFNLIVPLLTSQKVHFD
AQKEIARAQEVYETLTKTKEVTDKNPNNTDQREGEKTPGVKTGFFNWMNVWKFIRIWPLKYSQ*
38 >lcl|XP_003434054.1|Plus1<34857854..34858390 NW_876297 14-3-3 protein theta-like LOC478521 __SEG__ Chr32 {Canis lupus familiaris} NLDTSDKKLQLIKDNQEKVESERRSVCTAVLESLVKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTMHNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVF
YYEILNNPEFACTLAKTAFDEAIAEFDTRNEDSYKDSALVMQLLRDNLTLWTSDSAGEECDAAEGAEN*
39 >lcl|XP_003434093.1|Plus133993496..33993891 NW_876297 peptidyl-prolyl cis-trans isomerase NIMA-interacting 4-like LOC100683940 __SEG__ Chr32 {Canis lupus familiaris} MPPKEKSGSRKGRKGGAASGSDSSDKKAQGPKGGGNTIKVRHILCEKHGKIMEAMEKLKSGMRFNEVATQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGPDEPV
FTDPPIRTKFGYHIIMVEGRK*
40 >lcl|XP_003434095.1|Plus135904473..35904691 NW_876297 ubiquitin-like protein 5-like LOC100684298 __SEG__ Chr32 {Canis lupus familiaris} MIEVVCNDSLEKKVRVKCNTDDTIGDLKKLIAAQTGTCWNKTILKKWYMISKDQSLGDYEICDGMNLELYYQ*
41 >lcl|XP_003434405.1|Plus1complement(2656899..2657324) NW_876307 proteasome maturation protein-like LOC100684046 __SEG__ Chr3 {Canis lupus familiaris} MNARGLGSQLKDSIPVTELSISGPFEQHDLLRKGLPCVKNELLPSHPPELSEKNFQFNQDKMNFSTLRNIQSLFAPLKLQMEFKAVQQVQRLPFLPSSNLSLDILRGNDE
TIGFEDILNDPSQSELMREPHLMVEYKLGLL*
42 >lcl|XP_003434583.1|Plus1complement(50694680..50695132) NW_876311 heat shock protein beta-3 HSPB3 __SEG__ Chr4 {Canis lupus familiaris} MAKIILRHLIETPVRYEEEFEARGLEDCRLDHALYALPGPTTVDLRRARAAQVPPVDSVAEMPTQEGKSRFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFI
SRSFTRQYKLPDGIETKDLSAILCHDGILVVEVKDPAGTK*
43 >lcl|XP_003434588.1|Plus18483894..8484352 NW_876311 ubiquitin-conjugating enzyme E2 N-like LOC607889 __SEG__ Chr4 {Canis lupus familiaris} MAGLPRRIIKEPQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDFPFEGGTFKLELFLPEEYPMAAPKVCFMTKIYHPNIDKLGRICLDILKDKWSPTLQICTVLLSIQA
LLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI*
44 >lcl|XP_003434616.1|Plus1complement(14572315..14573619) NW_876312 RING finger protein 26 RNF26 __SEG__ Chr5 {Canis lupus familiaris} MEAVYLIVNGVGLVLDLLTLVLDLNFLLVSSLLASLAWLLAFIYNLPHTVLTSLLHLGRGVLLSLLALIEALVRFTFGGLQALCTLLYSCYSGLESLKLLGHLASHGALR
SREILHRGVLNVVSSGHALLRQACDICAIAMSLVAYVINSLVNICLIGTQNLFSLMLALWDAVMGPLWRMTDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLL
TNFVLVNVTGLVLLACVLAVMVTVLHPDLTLRLATRALSQLHARPSYHRLREDVVRLSRLALDLEAWRRVWSRSLQLATWPNRGGAPGAPQGGPRRVPPARTWRQDTLPE
AGPRSEAEEEEEVRMARATAARGRERLNEEESVAGQDPWKLLKEQEERKRCVICQDPEQTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRGILQTLNVYL*
45 >lcl|XP_003434675.1|Plus18723522..8723743 NW_876313 ubiquitin-like protein 5-like LOC100686585 __SEG__ Chr5 {Canis lupus familiaris} MIEVVCNDRLGKKVRVRCNTDDTIGDLKKLIAAQTGTRWNKIILKKWYTIFKDHVSLGDYEIHDGMNLELYYQ*
46 >lcl|XP_003434702.1|Plus125029526..25029894 NW_876313 prefoldin subunit 1-like LOC490658 __SEG__ Chr5 {Canis lupus familiaris} MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAED
NIREMLMARRAQ*
47 >lcl|XP_003434792.1|Plus1complement(8753920..8756235) NW_876317 E3 ubiquitin-protein ligase TRIM56 TRIM56 __SEG__ Chr6 {Canis lupus familiaris} MVSQGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLAEGGHLRCPECRETVPVPPAGVAAFKTNFFVNGLLDLVRARAGGDLRAGKPACALCPLMGGA
GTGGPATARCLDCADDLCQACADGHRCTRQTHTHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFLCQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEELL
AGVDNNLAELESARMVEKEALARLREQAAKVGTQVEEVAEGVLRALLAQKQEVLGQLRAHVEAAEEAARERLGELESREQVARAAAAFARRVLSLGREAEILSLEGAIAQ
RLRQLQGCPWMPGPAPCLLPQLELHPGLLDKNCRLLRLSFEEQQPQKDSGKDEAGSQGGDETQSRREDGAKSERQGAIQPQSRDGAYAPKENRAQTPQEDGAQTPKEDRA
KTPQEDGAQTPKEGRAQTPLEDEGAQTPRGGRSNKKRKFKGRLKSISREPSPAPGLNLEGSGLLPRPIFSCSFPTRMPGDKRSPRITGLCPFGPREILVADEQNRALKRF
SLSGDYRGAVPVPEGCSPCSVAALQGAVAFSAGARLYLISPDGEVQWRRALSLSQASHAVAAMPSGDRVAVSVSGHVEVYNMEGSLATRFIPGGKANRGLRALVFLTTSP
QGNFVGSDWQQNSVVVCDGLGQVIGEYRGPGLHGCQPGSVSVDKKGYIFLTLREVNKVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGRHLVVSLSNGTIHVFRVRSPD
S*
48 >lcl|XP_003434902.1|Plus112183179..12183487 NW_876321 10 kDa heat shock protein, mitochondrial-like LOC100685272 __SEG__ Chr6 {Canis lupus familiaris} MAEQVFREFFPLFDGVLVERNAAETVTKGGIMLPEKSQGKVLQATVVAVGSGPKGKGGEIEPVSVKVGDKVLLSEYGGTKVVLDDKGYFLFRDGDIIGKYVD*
49 >lcl|XP_003434943.1|Plus140462155..40462433 NW_876323 dolichol-phosphate mannosyltransferase subunit 3 DPM3 __SEG__ Chr7 {Canis lupus familiaris} MTKLAQWLWGLALLGSTWAALTTGALGLELPSPCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGMRF*
50 >lcl|XP_003435091.1|Plus143671884..43673059 NW_876327 heterogeneous nuclear ribonucleoprotein G-like LOC100684739 __SEG__ Chr8 {Canis lupus familiaris} MALQDVCKWQAPDTQGLSPHLPPAGGWSVPLGCDPQTFLRLHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGNYVACPASRKIIPVHQHLLGTTSGTSADCAAWYRVLRR
ELRLRALREGRLPSVAGAARLLSAMMSCYRGLDLCVATALCGWDRSGPALFYVCSDGTRLPGNVFSVGSGSPYAYGVLDRGYRYDLSPQEAYALARRAVAHATHRDAYSG
GSVDLFHVREDGWEYVSRDDACVLYSELQKLPEPEGAAAEEGHAEPATLRGDSRMPAGTEML*
51 >lcl|XP_003435133.1|Plus1complement(41986391..41988589) NW_876327 disintegrin and metalloproteinase domain-containing protein 20-like LOC100682819 __SEG__ Chr8 {Canis lupus familiaris} MGPAWAQAHLTGNLWLPLLWLLLSPGCCSRALPGWRFTSSEVVIPRKVSHRVGGMERQGHLSYKIHFRGQRHVVHMKVKKNLLPRHFPVITDNDQGAMQEDYPFVPRDCY
YYSYLEGVPGSMGTLDTCNGGLRGMLQVDDFTYEIKPLEASSTFEHVVSLLVTEGRSSEAQKCKIGEQDTDQAYEEAMLAGTPRAGPVYLWQSHRKFLKIHYTISHSLYL
MRPNITQAIEGVVMINSILHTIYQQSLINVYIRLLCIWNDRDHVEITKKKSAYSAVEDFGLWKYYGFFYKIEHDTSLLLTGHKIVGSIYFAHHGGTCNPNWGAMFVYVAN
YHIFLAGGISAHTLGHSLNLVHDVFGCKCFRRSHCVMTEQPGLMDMLSNCSYDSLHRRVSGWDPCMSIPNVPYTNFPYVAPRCGDKIRNQLEECDCGSLKDCNDNKCCET
NCAFSLGSDCSEGSCCVNCKYAQPGLLCRDILGICDLPEYCDGTSHNCPNDVYTQDGTPCSTLAVCVRGNCTDRDMQCQSLFGYGIKDAAPACYEKLNVLGDRFGNCGVR
VVRGGGKPVRCEEDDVLCGMLHCRDVEEIPGGGDHVTFRHIIVTGINQEKCFGYDAHHGTEIPEMGLVVDGATCGPGKYCLNQNCTFYQDMGFDCDVSTCNFRGVCNSKK
HCHCMRGWKPPTCEEKGAGGSIDSGPPPDREYVLRGKVTVSVNRALGLIVIRTLLFLTGLIIGLFFQLKKRY*
52 >lcl|XP_003435134.1|Plus1complement(41998470..42000689) NW_876327 disintegrin and metalloproteinase domain-containing protein 20-like LOC100682897 __SEG__ Chr8 {Canis lupus familiaris} MAEPLSPGKTTDQVCTFLFKKPGGGRGAAGRRRRGRCDQEPGDRGSGSDQGSAVVRPEKQRAAGDPMIQTTRGRGRGRGTQKAACGHPSSEEEGAEEPEAQSLGVAYRST
RSATPAGPGDVGATARSEPDPGEERDAQAIFERSRKIQEELRPKEDDKIYRGSNNYQKYMKPKDTSLGRASSGMVRKGPIRAPEHPCATVRWDYQPDTCKDFKETGFCGF
GDSCKFLHDRSDYKHGWQVERELEDGRYGVYGDENYDVGSDDEEIPLRCLICRQTFENPVVTRCRHYFCESCALRHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRAA
EEGDASDFPEDLDEAPIATT*
53 >lcl|XP_003435171.1|Plus1complement(14051813..14052181) NW_876327 prefoldin subunit 1-like LOC100688100 __SEG__ Chr8 {Canis lupus familiaris} MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNTTKKHAHLIDTEIMTLVDETNMYESVGRMFILQSKEVIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAED
NIREMLMARRAQ*
54 >lcl|XP_003435192.1|Plus1complement(34095195..34095620) NW_876327 proteasome maturation protein-like LOC100684256 __SEG__ Chr8 {Canis lupus familiaris} MNARGLGSQLKDSIPVTELSASGPFEQHDLLRKGLPCVKKELLPSHPPELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQHVQCLPFLPSSNLSMDILRGNDE
TTGFEDILNDPSQSELMGEPHLMVKYKLGLL*
55 >lcl|XP_003435342.1|Plus1complement(19847945..19848403) NW_876332 ubiquitin-conjugating enzyme E2 N UBE2NL __SEG__ Chr9 {Canis lupus familiaris} MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKG
EMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIF
EVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLD
KGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSS
VLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTY
NIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGGGSGASGGPTIEEVD*
56 >lcl|XP_003435367.1|Plus1619687..620031 NW_876333 notch-regulated ankyrin repeat-containing protein-like LOC100683070 __SEG__ Chr9 {Canis lupus familiaris} MAEPLSPGKTTDQVCTFLFKKPGGGRGAAGRRRRGRCDQEPGDRGSGSDQGSAVVRPEKQRAAGDPMIQTTRGRGRGRGTQKAACGHPSSEEEGAEEPEAQSLGVAYRST
RSATPAGPGDVGATARSEPDPGEERDAQAIFERSRKIQEELRPKEDDKIYRGSNNYQKYMKPKDTSLGRASSGMVRKGPIRAPEHPCATVRWDYQPDTCKDFKETGFCGF
GDSCKFLHDRSDYKHGWQVERELEDGRYGVYGDENYDVGSDDEEIPLRCLICRQTFENPVVTRCRHYFCESCALRHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRAA
EEGDASDFPEDLDEAPIATT*
57 >lcl|XP_003435627.1|Plus18989719..8990234 NW_879563 cellular nucleic acid-binding protein-like LOC100684286 __SEG__ ChrX {Canis lupus familiaris} MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNTTKKHAHLIDTEIMTLVDETNMYESVGRMFILQSKEVIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAED
NIREMLMARRAQ*
58 >lcl|XP_531723.1|Plus17891340..7892269 NW_876251 dnaJ homolog subfamily B member 7 DNAJB7 __SEG__ Chr10 {Canis lupus familiaris} MVDYYEVLGVQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNNEKRDIYDKYGQEGLNGGDRSHFEDSSEYSFTFRKPSDVFREIFGEKDPFSF
HFFEDSLEDLLNSPRSSYASRSTKSCFATSSEYPVFERFPSYDTGYIPYGSLGHEGLNSFSSLAFDDSGMGNYISVTTSSKIANGRNTNTQSIIENDQEREVVEDDGELK
SFFINGVADEEGFEEECTWRRQSFNNYSPKSYSPKHATQYTFVDSDEQDIPWVTSNWNPSIFSAGFKERGKRKKKKHKEVQKKSTKRNC*
59 >lcl|XP_531805.2|Plus1complement(31493966..31495144) NW_876251 dnaJ homolog subfamily A member 1-like isoform 1 LOC474576 __SEG__ Chr10 {Canis lupus familiaris} MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDTKKRELYDKGGEQAIKEGGAGGGFGFPMDIFDMFFGGGGRMQRERRGKNVVHQ
LSVTLEDVYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGIQIRIHQIGPGMVQQIQSVCMDQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQK
ITFHGEGDQEPGLEPGDIIIVLYQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDSRTIVITSHPGQIVKHGDIKCVLNEGMPIYHRPYEKGHLIMEFKVNFPEN
DFLSPDKQKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS*
60 >lcl|XP_532082.1|Plus1complement(1284117..1286042) NW_876254 heat shock 70kDa protein 1-like isoform 1 HSPA1L __SEG__ Chr12 {Canis lupus familiaris} MAVAKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEGGKPKVMVSYK
GEKKAFYPEEISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKTGQGERHVLIFDLGGGTFDVSILTIDDGIFE
VKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDK
VKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGV
LIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKISAKNALESYAFN
MKSAVSDEGLKGKINDSDKKKILDKCNEVLSWLEANQLAEKEEFDHKRKELEQVCNPVITKLYQGGCTGPSCGTGYTPGRAATGPTIEEVD*
61 >lcl|XP_532386.1|Plus19982764..9983363 NW_876257 peroxiredoxin-1-like isoform 1 LOC475156 __SEG__ Chr13 {Canis lupus familiaris} MSSGNAKIGHPVPNFKATAVMPDGRFKDLSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFSHLAWINTPKKQGGLGPMNIPLVSDPKH
TIAQDYEVLKADESISLRGLFVIDDKGILWQITVNDLPVGHSVDESLRLVQAFPFTDKHGEVCSAGWKPGSDTIKPDVQKSKEYFSKQK*
62 >lcl|XP_532423.2|Plus1complement(6467082..6467714) NW_876258 glutathione S-transferase P-like LOC475191 __SEG__ Chr14 {Canis lupus familiaris} MPPYTITYFPVRGRCEAMRMLLADQSQSWKEEVVTMETWMKGSLKASCLYGQLPKFQDGDLTLYQSNAILRHLGRSLGLYGKDQQEAALLDVVNDGVEDLRCKYALLIYT
NYEAGKEEYVKALPGYLKPFEKLLSQNEGGQAFIVGNQISFADYNLLDLLLIHQVLAPSCLDSFPLLSAYVACLSARPKLKAFLSSPEHVNRPINGNGKQ*
63 >lcl|XP_532535.2|Plus1complement(60393294..60394196) NW_876258 RING finger protein 148 RNF148 __SEG__ Chr14 {Canis lupus familiaris} MSLLRITPSSVSPQLLRLSIFLLLSLPDSKGKSIWTAHLNITFQVGNRIISELGESGVFGNHSPLERVSGAVVLPEGWNQNACNPMTNFSRPEQAHSWLALIERGGCTFT
HKINVAAEKGANGVIIYNYPGTGNKVFPMSHQGTENIVAVMIGNLKGMELLHLIQKGVYVTIIIEVGRMHMPWLSHYVMSLFTFLAATVAYLFLYCAWRPRVPNSSTRRR
RQMKADVKKAIGQLQLRVLKEGDKELDPNEDSCVVCFDIYKPQDVVRILTCRHVFHKACIDPWLLAHRTCPMCKCDILKT*
64 >lcl|XP_534679.3|Plus19463846..9466287 NW_876282 disintegrin and metalloproteinase domain-containing protein 1a-like LOC477481 __SEG__ Chr26 {Canis lupus familiaris} MAASLRHSASFLSSLQKYQVVTYEAGQVFQTWAPHVKDLRRALVAPGPLCVRLGVLLLLVLIFLPSLYCDPGSVYYSSYETVIPKSLTAKGREDPGEKASYVLLMQGQKQ
VIHLKVKRDYFVSNFPVFSYHNGVLGQEMPFISHDCHYEGYIEGVPGSFVSLNTCSGLRGILIREGKPYGIEPMDTSKRFEHVLYTMAHQARVSCNVTSKGSQVVSTSRQ
QGSREPRSLQAPSSFWSHTKYVEMFVVVNHQRFQMWGSNVNETVQRVMDITALANIFTRGINTEVVLAGMEIWTEGDLIEVPADLRVTLRNFNSWRQEKLFHRVEHDVAH
MIVGHHPEGDAGQAFLNGACSGGFATAVESFHHEDVLLFAALMVHELGHNLGIQHDHSACICKDKHFCLMHENITKESGFSNCSSDYFYKFLREHKGACLFNKPRPKGRL
RRQATCGNGVLEEDEQCDCGPDCGNNLCCDQTCRLKEQAQCNDGLCCFNCQFRHKGFMCRSALGECDLPEYCDGISDRCPTDLYKQDGTVCDIIHYCFRGRCKNPDIQCM
DIYGSPAVSAPEDCYISMNSKGNRFGNCGCPTAVVPRYVKCFDENIFCGKLVCTNITQVPPIKPYHTVIQVAHKDDWCWSMDAYNISDIPDDGDVHTGTLCAPHKVCMNY
SCTDHVVLKYDCEPKEMCNGRGVCNNLKHCHCEAGYAPPDCKAPGNGGSVDSGPPGYLDDGIPREDKSKSHSFDRGNFGKGGENADESKSLGNLLYIFPLFLVAIFLSLI
IAASVGARKEISQCSQEALEETEEVAVQKEVGRLEEDVEGKNE*
65 >lcl|XP_534790.3|Plus1complement(17809484..17809948) NW_876307 prefoldin subunit 5 PFDN5 __SEG__ Chr3 {Canis lupus familiaris} MTQSVNITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLHVLNKNNEGKELLVPLTSSMYVPEKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFL
TKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGATQATAKA*
66 >lcl|XP_535147.2|Plus1complement(12327856..12328407) NW_876290 T-complex protein 1 subunit beta-like LOC477960 __SEG__ Chr2 {Canis lupus familiaris} MIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSELLMAHAVTQLASRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLV
AQLRAAHSEGNRTAGLDMKEGTIGDMAVLGITESFQVKQQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC*
67 >lcl|XP_535784.2|Plus1<111171..112616 NW_876300 dipeptidyl peptidase 1 CTSC __SEG__ Chr34 {Canis lupus familiaris} FKARVVRPAWPSASAPRHGPRRHGSPASPLLSAALLLLSGFGAAHHDTPANCTHPELLGTWVFQVGPAGSRSVNCLVMGPPEKKVVVHLEKLDTAYDNFGNTGDFTIIYN
QGFEIVLNDYKWFAFFKYKEEGHRVTSYCNETMTGWVHDVLGRNWACFTGTKMGTTSEKAKVNTKHIERLQENNSNRLYKYNYEFVKAINTIQKSWTATRYIEYETLTLR
DMMRRAGGRKIPRPKPTPLTAEIHEEISRLPTSWDWRNVRGTNFVSPVRNQASCGSCYAFASTVMLEARIRILTNNTQTPILSPQEIVSCSQYAQGCEGGFPYLIAGKYA
QDFGLVDEACFSYAGSDSPCKPNDCFHYYSSEYHYVGGFYGACNEALMKLELVRHGPMAVAFEVYDDFFHYQKGIYYHTGLRDPINPFELTNHAVLLVGYGTDSASGMDY
WIVKNSWGSRWGEDGYFQICRGTDECAIESIAVAATPIPKL*
68 >lcl|XP_536238.1|Plus131086357..31087286 NW_876307 heparan sulfate glucosamine 3-O-sulfotransferase 1 HS3ST1 __SEG__ Chr3 {Canis lupus familiaris} MVSRTAALLLGAVLLAAQLPLVPSRPAAPGAEPGRAATLQGEGRDGAAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGLGWYLGQMP
FSSPHQLTVEKTPAYFTSPKVPERVHSMNPGIRLLLILRDPSERVLSDYTQVFYNHVQKRKPYPSIEEFLVRDGRLNVGYKALNRSLYHVHLQNWLRFFPLRRIHIVDGD
RLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDGGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNRKFFELVGRTFDWH*
69 >lcl|XP_537309.3|Plus1complement(4292300..4293352) NW_876324 RING finger protein 113A-like LOC480186 __SEG__ Chr7 {Canis lupus familiaris} MAEPLSPGKTTDQVCTFLFKKPGGGRGAAGRRRRGRCDQEPGDRGSGSDQGSAVVRPEKQRAAGDPMIQTTRGRGRGRGTQKAACGHPSSEEEGAEEPEAQSLGVAYRST
RSATPAGPGDVGATARSEPDPGEERDAQAIFERSRKIQEELRPKEDDKIYRGSNNYQKYMKPKDTSLGRASSGMVRKGPIRAPEHPCATVRWDYQPDTCKDFKETGFCGF
GDSCKFLHDRSDYKHGWQVERELEDGRYGVYGDENYDVGSDDEEIPLRCLICRQTFENPVVTRCRHYFCESCALRHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRAA
EEGDASDFPEDLDEAPIATT*
70 >lcl|XP_537479.1|Plus136839906..36841819 NW_876327 heat shock-related 70 kDa protein 2 isoform 1 HSPA2 __SEG__ Chr8 {Canis lupus familiaris} MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKG
EMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIF
EVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLD
KGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSS
VLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTY
NIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGGGSGASGGPTIEEVD*
71 >lcl|XP_537776.1|Plus1complement(28846887..28847519) NW_876332 glutathione S-transferase P-like LOC480657 __SEG__ Chr9 {Canis lupus familiaris} MGPAWAQAHLTGNLWLPLLWLLLSPGCCSRALPGWRFTSSEVVIPRKVSHRVGGMERQGHLSYKIHFRGQRHVVHMKVKKNLLPRHFPVITDNDQGAMQEDYPFVPRDCY
YYSYLEGVPGSMGTLDTCNGGLRGMLQVDDFTYEIKPLEASSTFEHVVSLLVTEGRSSEAQKCKIGEQDTDQAYEEAMLAGTPRAGPVYLWQSHRKFLKIHYTISHSLYL
MRPNITQAIEGVVMINSILHTIYQQSLINVYIRLLCIWNDRDHVEITKKKSAYSAVEDFGLWKYYGFFYKIEHDTSLLLTGHKIVGSIYFAHHGGTCNPNWGAMFVYVAN
YHIFLAGGISAHTLGHSLNLVHDVFGCKCFRRSHCVMTEQPGLMDMLSNCSYDSLHRRVSGWDPCMSIPNVPYTNFPYVAPRCGDKIRNQLEECDCGSLKDCNDNKCCET
NCAFSLGSDCSEGSCCVNCKYAQPGLLCRDILGICDLPEYCDGTSHNCPNDVYTQDGTPCSTLAVCVRGNCTDRDMQCQSLFGYGIKDAAPACYEKLNVLGDRFGNCGVR
VVRGGGKPVRCEEDDVLCGMLHCRDVEEIPGGGDHVTFRHIIVTGINQEKCFGYDAHHGTEIPEMGLVVDGATCGPGKYCLNQNCTFYQDMGFDCDVSTCNFRGVCNSKK
HCHCMRGWKPPTCEEKGAGGSIDSGPPPDREYVLRGKVTVSVNRALGLIVIRTLLFLTGLIIGLFFQLKKRY*
72 >lcl|XP_537961.3|Plus110478483..10479115 NW_879562 glutathione S-transferase P-like LOC480844 __SEG__ ChrX {Canis lupus familiaris} MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD*
73 >lcl|XP_538154.2|Plus1complement(43282777..43283823) NW_879563 RING finger protein 113A RNF113A __SEG__ ChrX {Canis lupus familiaris} MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD*
74 >lcl|XP_538845.1|Plus1complement(1528423..1529472) NW_876254 FK506 binding protein like FKBPL __SEG__ Chr12 {Canis lupus familiaris} METPPASLIGDKDTSQPQQRREENPQENLKSTTEIRQQPQDCPTEILELRVSSALASRVLEKPQETEKLAAGLEGDSVKSPGSTSGMPEPLPASDLWYCPDGSFVKKIII
RGHGLDKPKLGSCCRVLAFGFPFGSGLPEGWTEITMGLGPWREGTWGELIEKCLESMCQGEEAQLQISEHPESPFRLTLASFTQGRDSWELEASEKEALAKKERTRGTEL
FRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLEREPDHLKALYRRGVAQAALGNLDKATADLRKVLAVDPKNRAAQEELGKVI
IQGKKQDAGLAQGLRKMFG*
75 >lcl|XP_538923.2|Plus1complement(11337455..11338621) NW_876254 tubulin-specific chaperone C TBCC __SEG__ Chr12 {Canis lupus familiaris} MGKENKAGADVSVSGQSQRALVGGLTEGAPGGSKAAAGKLEAKMEAASCSAAAANGAVGSQRDRSLVPERLQRREQERQLEVERRKQKRQNQEVEEEKSDFFAAAFARER
AAVEELLESGESMEQLDEAAARLQGLQKLVNDAVLFLAAYDLRQGQEALTRLQATLAERRQELQPKKRFAFKTRRKDAVSATTVDAAPGPAAAEGILAFPPPLKEEGGGI
GSGFVFGFSNVESQVLEKRAEELHQRDVLLTELSKCTVRLYGNPNTLRLAKARGCTLLCGPVSTSVFLEDCSDCVLAVACQQLRVHTTRDTRIFLQVTSRAIVEDCSGIQ
FAPYTWSYPGIDKDFEGSGLDRSKNNWNDIDDFNWLARDTASPNWSILPEEERTVQWD*
76 >lcl|XP_539926.1|Plus116202690..16204357 NW_876260 chaperonin containing TCP1, subunit 8 (theta)-like 2 CCT8L2 __SEG__ Chr16 {Canis lupus familiaris} MAGGATAAPPLPERLGPGPRRRARGPGAQEEHLLCSVPAAQTLARVIRPCYGPHGRQKLLVTARGTTVFTGSAAAILQALELEHPAARLLREAAHKQAESCGDGAAFVVL
LAEALLQQAEHLLRAGLPRSQLREAYAAATAEVLALLPSLSIRSLGPLEDPFWALYSVMNTHSASQMDYLTKLVAHACWATKELDGSFHRERVGVCTLRGGRLEDSCLLP
GMALAAKPCGQVISVLHGARVALFVCAFGPASPNAPATARLSSSADLTKFRKGSEQLIEKQVAQLVTASINVVVVWGNINENTLTLADKYGIMVIQARSRRDMVYLSEVL
GTPLMPYLIPPLKPGKCQRVYQQDLGEGMAVVFEWECPATPALTIALRGATAEGLKSAEQAAYHGIDAYFQLCQDPRLLPGAGATEMALAKILSEKGSRLEGLNGPAFLA
FAQALQSLPETLAENAGLVVSEVMAEMKGAHQAGNLLVGVGVEGIINVTQEGVWDTLVAKAQGLRAVADVALQLVNVDEIIVAKKSPMCQQDSNPVPKKAKECLSPVKKS
NPWNN*
77 >lcl|XP_539996.2|Plus114103087..14103944 NW_876261 protein phosphatase 1 regulatory subunit 3B PPP1R3B __SEG__ Chr16 {Canis lupus familiaris} MMAVDIEYRYSCMAPSLRRERFTFKTSPKPSEPLRPCIQLSSKNEASGVVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDEPLDIPFNITELLDNLVSLTSPESESF
VLDFTQPSADYLDFRNRLQADHVCLENCVLKDRAIAGTVKVQNLAFEKMVKIRMTFDTWKSFTDFPCRYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCFECSGQT
YWDSNKGKNYRITRAELKSAQGTAEPQNGPDFGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY*
78 >lcl|XP_540351.3|Plus1complement(1776329..1778359) NW_876265 fidgetin-like 1 FIGNL1 __SEG__ Chr18 {Canis lupus familiaris} MQASSSGSVHLSEWQKNYFAITSGTCTAGQKADAYRAQILRIQYAWANAEMSPACATRLFRRYAERYSAVIDSDNVETGLNNYAESILTLARSQQTDSDRWQSGLSINNV
FKMSNVQEMMQASKKSRDSLLAPADASVVIHQEAVVLDPPKLSVCGGSGEGCPLTNSAHDTTRTLDIPEGSPPKCPQSALPPALPSTGKTCPTSVTPLGDFATAKIHATP
LFGNVRKHSNSSPKANVGLNVFSSNQSCLPSVCEDPRERRAFYGSGTVDALSASMVNKAFSKTGDNGQREEGSLPTFKTAKEQLWVDQQKKYQQAQRVSGSSYGGVKKSL
GASRSRGIFGKFVPPLPKQDGGDQNGGVQYKPYIPGPAEPAHPVDERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGIL
LFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRP
QEIDEAARRRLVKRLYIPLPEASARRQIVINLMSKEQCCLSEEEIALVVRQSDGFSGADMTQLCREASLGPIRSLQTADIATIAPEQVRPIAYVDFENAFRTVRPSVSPK
DLELYENWNRTFGCGK*
79 >lcl|XP_541025.1|Plus16985261..6985722 NW_876268 peptidyl-prolyl cis-trans isomerase A-like LOC483905 __SEG__ Chr19 {Canis lupus familiaris} MINPTIFFDIAMDSEPLGQSSKTTENFHTLSTGEKGFGFKVSCFHGIFPGFICHGGEFTCYNGTGGKAIYGEKFDDENFILKHTSPGILSMANVGTNTDSSKFFICAVKV
EWLDGKHVVCGKVKDSMNITEAMVCFGSRNGRTSKKITIAECG*
80 >lcl|XP_541548.2|Plus140019026..40020780 NW_876270 interferon regulatory factor 2-binding protein 1 IRF2BP1 __SEG__ Chr1 {Canis lupus familiaris} MASVQASRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHVLPEGRSPGPPALKHPTTKDLAAAAAQGPQLPPPQAQPQPSGTGGGISGQD
RYDRATSSGRLPLPSPALEYTLGSRLANGLGREEAVAEGARRALLGSMPSLVPPGLLAAAVSGLGSRGLTLAPGLSPARPAFGSDFEKEKQQRNADCLAELNEAMRGRAE
EWHGRPKAVREQLLALSACAPFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTEYPCGSGNVYAGVLAVARQMFHDALREPGKALASSGFKYLEYERRHGSGEWRQL
GELLTDGVRSFREPAPAEALPQQYPEPAPAALCGPPPRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPYSADTPGVPSPIAALKNVAEALGHSPKDP
GGGGGPVRAGGASPAASSTAQPPAQHRLVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGD
KCPLVGSSVPWAFMQGEIATILAGDIKVKKERDP*
81 >lcl|XP_543078.1|Plus1complement(44530125..44531024) NW_876277 protein phosphatase 1 regulatory subunit 3D PPP1R3D __SEG__ Chr24 {Canis lupus familiaris} MSGGWGSAALPPGPGARKPAPRSLSCVSDLDGGAAPEPRPCRPPGSPGRAPPPPPAPSGCDPRLRPIILRRARSLPSSPERRQKAGGASGAACRPGCSRQLRVRFADALG
LELAQVKVFNAGEDPAVPLHVLSRLAINSDLCCSSQDLEFTLQCLVPDFPPPIEAADFAERLAQRLICLERVTCSDLGISGTVRVRNVAFEKQVAVRYTFSDWRSAHEAV
ARWRGPAGAGGTEDVFAFGFPVPPFLLALGSRVHFALRYRVAGAEYWDNNHGRDYSLTCRNHALHMPRGECEESWIHFI*
82 >lcl|XP_544136.2|Plus1complement(24943733..24944650) NW_876288 peroxisome biogenesis factor 2 PEX2 __SEG__ Chr29 {Canis lupus familiaris} MASREEKTKRTDRVLRISQLDALELNKALEQLVWAQFTQCFHGFKPGLLAHFEPEVKALLWLFLWRFTIYSKNATVGQSVLNIQYKNDFSPKLRYQPPSKNQKLWYAVCT
IGGTWLEERCYDLFRNRHLASFGKARQCVNIMVGLLKLGGLINFLIFLQRGKFATLTERLLGIRSVFCKPQNVREVGFEYMNRELLWHGFAEFLIFLLPLINIQKLKAKL
SSWCIPLTGAPTSDNTLATSGKQCSLCGEWPTMPHTIGCEHIFCYYCVKSSFLFDMYFTCPKCGTEVQSLQPLKSGIEMSEVNAL*
83 >lcl|XP_544526.1|Plus144292489..44293349 NW_876292 RING finger protein 186 RNF186 __SEG__ Chr2 {Canis lupus familiaris} MTDGCCHQAPDEAEREAETPGPRPGCIQVPAAPADTPWQCPGPEPPRPADAVPGMACAEVPQPPAPRQPQPVSAKATTATEASDPAGDHCASADGDLECLVCREPYSYIR
PPKLLGCQHSFCAVCLKLLLCVQDNTWSIVCPLCRKATAVPGGLICSLRDHEAVVGRLVRPCLEVRLCPQGLADPASVAAGCPSSVGEDGQDAESANRVAARRLAAHLLL
LLGLIILILPFIYPGIMRWVFAVVISLALLMSSLFCCHPSSQGGCRPAPRTLFCRGRKHSEISSIA*
84 >lcl|XP_544648.1|Plus1complement(10181445..10183508) NW_876294 leucine carboxyl methyltransferase 2 LCMT2 __SEG__ Chr30 {Canis lupus familiaris} MGPRGRERRSGAVQSTNDSSALSKSSLAAHGYVQDPFAALLVPGTARRAPLIHRGYYVRARAVGHCVRAFLERTCAAPGAPRAQVVSLGAGSDSLYFRLKTEGRLTGAAV
WEVDFPDVARRKAERIQDTPELCELTGPFQSRDPASVLCFEGADYRLLGLDLRQLPRLDQALAAAGLDAAAPTLLLAEAVLTYLEPNDAAALIAWAAQRFPDALFVIYEQ
MRPHDAFGQFMQQHFRQLSSPLHGLDRFPDVEAQQHRFLQAGWTDCRAMDMNEFYRCFLSSEECQRVENLEPFDEFEEWHLKCAHYFILAASTGDTLSQTPVFPLSEVFP
RVDPASPSGVFPARVVTSDSQGRNLKRYGHASVLLSPSIILSTGGFGEQEGRHCRVSKFHLLSRFCDFEWKGNQICSCGTGALWDGRLYHTMTRLSDTQVLVLGGRLSPV
TPALGILQLGVCKSEDNSTEDLNVTVKKAGPEDSTLSCWRHSTTEVSYENQKYLFVYGGRSVVEPVLSDWHFLHMGTMAWVSIPVEGEAPEGRHSHSACSWQGGAVIAGG
LGVSEEPLSSVLFLKPSSCGFLWESIVIQPPITPRYSHTAHVLNGKLLLVGGVWIHSSSVPGVTVIDLTTGLSSEYQIDTTCVPWPLMLHNHTSILLPEEQQLLLLGGGG
NCFSFGTYFNPHIVTLDLSSLSAGESD*
85 >lcl|XP_545257.3|Plus1complement(14022166..14023380) NW_876301 tripartite motif-containing protein 59 TRIM59 __SEG__ Chr34 {Canis lupus familiaris} MHNFEDELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCRSIIEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCL
LDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLARLIEKLEEQKSNSEKMVQSDKELVLQYFKELSDTLEQKKKIFLAALCDVSNLINQEYTP
QIERMKEMREQQLELMTLTTSLQEESPLKFLEKVDDIRQHVQILKQRPLPEVQPVEIYPRVSQILKEDWNRTEIGQIKKLLIPEMKISSKRMPCSWPDKDENEVEFFKIL
NIVIVTLISVILMLILFFNQHIITFLNEITSVCFSEVFLSVYQSLSNNLHDLKNMLCHTLYLLKEFLWKILVSR*
86 >lcl|XP_545347.2|Plus113364353..13365096 NW_876302 E3 ubiquitin-protein ligase RNF182 RNF182 __SEG__ Chr35 {Canis lupus familiaris} MASQPPEDTAEAQVSDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGRGKKCLPENPTELLL
TPKRLASLVSPSHASSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVP
SSLVILMVYGFCQCVCHEFLDCMAPSS*
87 >lcl|XP_546376.3|Plus1complement(75853783..75854862) NW_876311 E3 ubiquitin-protein ligase RNF167-like LOC489258 __SEG__ Chr4 {Canis lupus familiaris} MAPAASALGVLRAALLAAVLGGPGPARALVRASSAHRRRMDFADLPALFGAALSREGLEGFLVEARPPDACSAVAPPPPGAVNGSVFIALLRRFGCDFDLKVLNAQRAGF
GAAVVHNVHSDALLSMVRGGAEAQQQIAIPSVFVGERSADYLRALFVYDKGAQVLLVPDDNLLLGYCLIPFTGVVGLLLVASGAGLVVRFVRHQGRLRRSRLTREQLERI
PTRDYQRGAPDDVCAICLDAYEVGERLRVLPCAHAYHSRCVDPWLTQTRRTCPVCKQPVRRSPGAGGPGQETRGQEEEGDEAGAPRAPPATERTPLLASSLPLPASFGSL
APAPGGVPGSAGDPAPSPSSSSSSAGVLV*
88 >lcl|XP_546612.2|Plus1complement(3129864..3130469) NW_876313 RING finger protein 222-like RNF222 __SEG__ Chr5 {Canis lupus familiaris} MSEGESKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTIVCPICRYVTFLSKKSSRWPSVLDRSSQTLAVPMGLPDALGHTNPQVWRPAP
SQGAQPPSDPPPGLVREPQVFVISRHGMPLGEQDSVLPRRSLAELSEASPAPSAGRAFCCRSRALLLITLVAVVAVVAAILPWVLLVRKQA*
89 >lcl|XP_546722.3|Plus1complement(187292..187987) NW_876314 RING finger protein 223-like LOC489602 __SEG__ Chr5 {Canis lupus familiaris} MSAPSRTSPTAPAPRSPSTPGSEKVASPLECSICFSGYDNIFKTPKELSCTHVFCLECLARLAAAQPTGRPGGEAVPCPFCRQPTAVPAAGAPALRTSHQLQARMPAHLR
REEPVWLEGTKLCCCLPPSVPGLGEPGIVCVDVGLSKPAEPTAPTPAPGPARRQGRLARCWARCRDWRRVALVTALLLVLFCVVLWPVQCALKTGNLHCLPRPSTTITTA
TAFSSRPLADN*
90 >lcl|XP_547254.2|Plus1complement(26795604..26796734) NW_876321 protein arginine N-methyltransferase 6 PRMT6 __SEG__ Chr6 {Canis lupus familiaris} MSQPKKRKLESGGGGGGGGEGSEEEDGGAPEAAPPRPRRARRERDQLYYECYADISVHEEMIADRVRTDAYRLGILRNWAGLRGKTVLDVGAGTGILSLFCVQAGARRVY
AVEASAIWQQARDVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLRSVLHARARWLKEGGLLLPASAELFVAPVSDQMLELRLGFWSQVKQLYGVDM
SCLESFATRCLMGHSEIVVQSLSGEDVLARPHCFARLELARSGLEQELEAGVGGRFRFSCYGSAPMHGFAVWFQVTFPGGDAEKPLVLSTSPFHPVTHWKQALLYLNEPV
PVEQDTDISGEITLLPSRDNHRLLRVLLRYKVGDQEEKTKDFAMED*
91 >lcl|XP_547726.1|Plus11200735..1201583 NW_876327 proteasome subunit beta type-11-like PSMB11 __SEG__ Chr8 {Canis lupus familiaris} MALQDVCKWQAPDTQGLSPHLPPAGGWSVPLGCDPQTFLRLHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGNYVACPASRKIIPVHQHLLGTTSGTSADCAAWYRVLRR
ELRLRALREGRLPSVAGAARLLSAMMSCYRGLDLCVATALCGWDRSGPALFYVCSDGTRLPGNVFSVGSGSPYAYGVLDRGYRYDLSPQEAYALARRAVAHATHRDAYSG
GSVDLFHVREDGWEYVSRDDACVLYSELQKLPEPEGAAAEEGHAEPATLRGDSRMPAGTEML*
92 >lcl|XP_548009.1|Plus1148014..150191 NW_876328 disintegrin and metalloproteinase domain-containing protein 29-like LOC490887 __SEG__ Chr8 {Canis lupus familiaris} MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD*
93 >lcl|XP_548093.2|Plus1complement(2589531..2590019) NW_876332 heat shock protein beta-9-like LOC490970 __SEG__ Chr9 {Canis lupus familiaris} MNARGLGSQLKDSIPVTELSASGPFEQHDLLRKGLPCVKKELLPSHPPELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQHVQCLPFLPSSNLSMDILRGNDE
TTGFEDILNDPSQSELMGEPHLMVKYKLGLL*
94 >lcl|XP_548354.1|Plus1677530..678327 NW_876333 RING finger protein 208-like RNF208 __SEG__ Chr9 {Canis lupus familiaris} MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNTTKKHAHLIDTEIMTLVDETNMYESVGRMFILQSKEVIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAED
NIREMLMARRAQ*
95 >lcl|XP_548908.2|Plus121598013..21598318 NW_879562 small ubiquitin-related modifier 1-like LOC491788 __SEG__ ChrX {Canis lupus familiaris} MNARGLGSQLKDSIPVTELSASGPFEQHDLLRKGLPCVKKELLPSHPPELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQHVQCLPFLPSSNLSMDILRGNDE
TTGFEDILNDPSQSELMGEPHLMVKYKLGLL*
96 >lcl|XP_548958.1|Plus1complement(36842412..36843038) NW_879562 type-1 protein phosphatase inhibitor 4-like LOC491839 __SEG__ ChrX {Canis lupus familiaris} MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKG
EMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIF
EVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLD
KGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSS
VLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTY
NIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGGGSGASGGPTIEEVD*
97 >lcl|XP_549029.2|Plus147800360..47802231 NW_879562 ubiquilin-2 isoform 1 UBQLN2 __SEG__ ChrX {Canis lupus familiaris} MAEPLSPGKTTDQVCTFLFKKPGGGRGAAGRRRRGRCDQEPGDRGSGSDQGSAVVRPEKQRAAGDPMIQTTRGRGRGRGTQKAACGHPSSEEEGAEEPEAQSLGVAYRST
RSATPAGPGDVGATARSEPDPGEERDAQAIFERSRKIQEELRPKEDDKIYRGSNNYQKYMKPKDTSLGRASSGMVRKGPIRAPEHPCATVRWDYQPDTCKDFKETGFCGF
GDSCKFLHDRSDYKHGWQVERELEDGRYGVYGDENYDVGSDDEEIPLRCLICRQTFENPVVTRCRHYFCESCALRHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRAA
EEGDASDFPEDLDEAPIATT*
98 >lcl|XP_549057.3|Plus15806197..5807057 NW_879563 OTU domain-containing protein 6A OTUD6A __SEG__ ChrX {Canis lupus familiaris} MALQDVCKWQAPDTQGLSPHLPPAGGWSVPLGCDPQTFLRLHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGNYVACPASRKIIPVHQHLLGTTSGTSADCAAWYRVLRR
ELRLRALREGRLPSVAGAARLLSAMMSCYRGLDLCVATALCGWDRSGPALFYVCSDGTRLPGNVFSVGSGSPYAYGVLDRGYRYDLSPQEAYALARRAVAHATHRDAYSG
GSVDLFHVREDGWEYVSRDDACVLYSELQKLPEPEGAAAEEGHAEPATLRGDSRMPAGTEML*
99 >lcl|XP_549264.1|Plus1complement(55263658..55266432) NW_879563 ubiquitin carboxyl-terminal hydrolase 26 USP26 __SEG__ ChrX {Canis lupus familiaris} MNARGLGSQLKDSIPVTELSASGPFEQHDLLRKGLPCVKKELLPSHPPELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQHVQCLPFLPSSNLSMDILRGNDE
TTGFEDILNDPSQSELMGEPHLMVKYKLGLL*
100 >lcl|XP_848225.1|Plus11922648..1923277 NW_876302 probable glutathione peroxidase 8-like LOC606843 __SEG__ Chr35 {Canis lupus familiaris} MEPLTAYPLRRSGSKAKVFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDAKGRTVSLEKFKGKVTLVVNVASDCQLRDRNYLAVQELHKEFGPFHFSVLAFPCNQ
FGESEPFPSKEVVSFARNNYGATFPIFHKIKILGSEADPAFRFLVDSSKKEPRWNFWKYLVNPEEQVVKSWRPEEPIEVIRPEIAALVTQMILRKKDDL*
101 >lcl|XP_848365.1|Plus1complement(142783..144981) NW_876328 disintegrin and metalloproteinase domain-containing protein 21-like LOC490886 __SEG__ Chr8 {Canis lupus familiaris} MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNTTKKHAHLIDTEIMTLVDETNMYESVGRMFILQSKEVIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAED
NIREMLMARRAQ*
102 >lcl|XP_848385.2|Plus1complement(670051..670515) NW_876333 RING finger protein 224-like LOC606841 __SEG__ Chr9 {Canis lupus familiaris} MALQDVCKWQAPDTQGLSPHLPPAGGWSVPLGCDPQTFLRLHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGNYVACPASRKIIPVHQHLLGTTSGTSADCAAWYRVLRR
ELRLRALREGRLPSVAGAARLLSAMMSCYRGLDLCVATALCGWDRSGPALFYVCSDGTRLPGNVFSVGSGSPYAYGVLDRGYRYDLSPQEAYALARRAVAHATHRDAYSG
GSVDLFHVREDGWEYVSRDDACVLYSELQKLPEPEGAAAEEGHAEPATLRGDSRMPAGTEML*
103 >lcl|XP_849543.2|Plus16933647..6935914 NW_876279 LOW QUALITY PROTEIN: disintegrin and metalloproteinase domain-containing protein 20 ADAM20 __SEG__ Chr25 {Canis lupus familiaris} MAEYGGSIMAVGEVLLCVRIAVPILWLRVFLLLSGWSHVGHFYHHGPPEVVIPLRITDRSIVKKPTGWLSYCLHFGGQRHVFHIKVKKLLLSKNFPVFTYTDQGALLEDQ
PFIRRDCYYHGHVEGDPDSLVSLSTCFGGFQGILQINHILYEILPKRLSTTFEHLVYKMYSEEKQFPPMRCGLTDEKIARHVKFQESSNSTLVQSEYEGLWMHKRYVEMA
VVVDYNRYAYREYNVTTVQLEVITTMNNVNTFYQPLNVDVSLVGMEVWNEGNPVEIENMDVLVDLFCAWKKKGFNARVPHDAAHVFVKRRYGILGISYVGSICNYNTNCA
VDAFTSDNLGFFAFVVSHELGHSLGMWHDEETCKCADNVCIMYAEQSQATKFSNCSYAQYWHTAVGSRCIFHPHTPERIFKYTRCGNGVLKKEKSVTVAP*MCVQKIHVV
S*TVL*VLELLVLLGFVAKTASSCHQVMYVENRLMNVIFLSGVMGHPISVQKMCTCKMESNAQVAATAMKRDAISVTNSVADFLAQMPRVQVRFATVQ*IFRVTVLVTVV
SRTINL*NVIPQIPCVGGCSVRMWQKSPL*ETILLCTGFTSMTASAGVQISTMGCPCLILVK*KMVQSVVKNVSVFKGSVSLWHI*KLIVHPRPAIGMGSATIDITAIVA
ISGSPPAAR*KAMEVVLIAAHPQ*ETGLKCHGRNSKRRLTSCYFSWCLLQFYYVVC*FGFL*EGKKWRRRKNRMFHLHPMNSRMNHLNLIKK*MKT
104 >lcl|XP_849766.1|Plus1complement(1817632..1818855) NW_876274 E3 ubiquitin-protein ligase TRIM13 TRIM13 __SEG__ Chr22 {Canis lupus familiaris} MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGTVRNSLWRASPFKCPTCRKETSATGVNSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDM
QLICGICATRGDHTKHVFCSIEDAYAQERDAFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTRDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEIN
KLNTILQEQRMAFNIAEAFKDVSEPIIFLQQMQEFREKIKVIKETPLPPSNLPTSPLMKNFDTSQWEDIKLVDVDKLSLPQDTGTFISKIPWSFYQLFVVVLLFSLLVFF
GPTIFLEGSLFDELTIWKDHLSNFSSYLTKSADFVEQSMFYWEQVMDGFFIFSEKFKNFMLVVLNNVADFVCKYKLL*
105 >lcl|XP_849769.1|Plus16596498..6597178 NW_876317 dnaJ homolog subfamily C member 30-like DNAJC30 __SEG__ Chr6 {Canis lupus familiaris} MAAKRDLRWSRRLLWRLWLLPSAPQTPGSGLGIDVRTYSQGDRPYSRTALYELLGVPSTATQAQIKAAYYRQSFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKY
DRGLLSDEDLRGPGVRPSRAPAGDAGSPRAPPPASRAHGRGQAATGASRTMFDFDAFYQAHYGEQLERERRQRARREALRRQQEERAKKGFRWDETRDTTFVFLLLMAFI
IMGFRF*
106 >lcl|XP_849937.1|Plus120962984..20964177 NW_876263 dnaJ homolog subfamily A member 1-like isoform 1 LOC608022 __SEG__ Chr17 {Canis lupus familiaris} MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQ
LSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQ
KITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPE
NGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS*
107 >lcl|XP_850180.1|Plus1complement(14092671..14093480) NW_876268 thioredoxin-dependent peroxide reductase, mitochondrial-like LOC608154 __SEG__ Chr19 {Canis lupus familiaris} MKIGEGGQSGESLAAVVGRFLQASIAGHVSAIPWGISASAALRPAASRRTCLTNVLWSGSGQAKFTFSTSSSYHAPAVTQHAPYFKGTAVVNREFKDLTLDDFKGRYLVL
FFYPLHFTFVCPTEIVAFSDKAKEFHDVNCDVVAVSVDSHFTHLAWINALQKNGSLGHMNIALLSDLTKQISREYGVLLEGPGIALRGLFITDPNGVIKHLSVNDLPVGR
SVEETLCLVKAFHFVETHGEVCPANWTPDSPIIKPDPSASKEYFEKVNQ*
108 >lcl|XP_850510.1|Plus1complement(5551123..5551914) NW_876254 proteasome subunit alpha type-1-like LOC608388 __SEG__ Chr12 {Canis lupus familiaris} MFRNQYDNDVTVWSPQGRIHQTEYAMEAVKQDSATLGLKSKTHAVLVALKRAQSELAAQQKKILHVANHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVS
LIGSKTQIPTQRYGRRPYGVGLFIAGYDDMGPHIFQTCPSANYFDCRAMSIGARFQSAPTYLERHMSGFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLE
FTIYDDDDVSPFLEGLEERPQRKAQPAHPADEPAEKADEPMEH*
109 >lcl|XP_850875.1|Plus1complement(24547380..24549011) NW_876301 T-complex protein 1 subunit eta-like isoform 2 LOC612825 __SEG__ Chr34 {Canis lupus familiaris} MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKP
YVEEGLHPQIIIRAFRTATQLAVNKIKEIVVTVKKEDKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVIMLDELLQLKMIGIKKVQGGALEESQLVAGVAFKKTF
SYAGFEMQPKKYNNPMIALLNVELELKAEKDNAKIRVHTVEDYQAIVDAEWNILYDKLERIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSI
QTSVNALSADVLGRCQVFEEMQIGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAK
ALEIIPCQLCDNAGFDATNILNKLRARHAQGGMWYGVDVNNEDIADNFEAFVWEPAMVHINALTAASEAACLIVSVDKTIKNPCSTVDAPPAAGRGRGRGRPH*
110 >lcl|XP_851402.1|Plus146586175..46586462 NW_876307 small ubiquitin-related modifier 2-like LOC609736 __SEG__ Chr3 {Canis lupus familiaris} MAEGKPKEEVMTENNEHIHLKVAGQDGSVVYFKIKKHTLLSKLMKAYCERQGLAVTQVRFRFDGHPIKGTDTPALLEMQDEDIIDVFQQQTGGLF*
111 >lcl|XP_851403.1|Plus1complement(10830736..10831413) NW_876258 ubiquitin-conjugating enzyme E2 N-like LOC609108 __SEG__ Chr14 {Canis lupus familiaris} MPLSCLHVLESFLWTAAGFSRISTQVANEKGLKSLEGKRFNYPLQILFCISKIQPDGCERSQGPEQRPNPGSDKTAGLPRRIIKETQRLLAEPVPGIRAEPDESNARYFH
VVIAGPQGSPFEGGTFKLELFLPEECPMAAPKVRFMTKIYHPNVDKLGRICLDVLKDKWSPALQIRTVLLSIQALSAPNPDDPLANDEAEQWKTNDAQAIETARAWTRLY
AMNNI*
112 >lcl|XP_851556.1|Plus114883904..14884293 NW_876316 prefoldin subunit 6-like LOC609675 __SEG__ Chr5 {Canis lupus familiaris} MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARATVGKRLDYITAEIKRYESQLQDLEWQSEQQRETLAQ
LQQEFQRAQAAKAGASGMA*
113 >lcl|XP_851591.2|Plus1complement(14966479..14968086) NW_876262 ubiquitin carboxyl-terminal hydrolase 17-like protein 2-like LOC609268 __SEG__ Chr16 {Canis lupus familiaris} MEAAHLHPSEEPQFSASPKPQSYWSRGGGAEVHGGPSVPETTSPASKTLSSPTDPLAPTSAGLPPTKTPLSWRSLSQVGAGLQNMGNTCYVNATLQCLTYTEPLASYMLS
QQHGTTCRRQTSCMLCTLQAHLTRVLCHPGRVLRPLPLLLAAFHRHKQEDAHEYLMFILDAMQQACLPEDKLSDPECPQDSTLIQQLFGGYWRSQIQCLHCQGISSTLEP
YLDISLDIGAAHSISQALEQLMKPELLEGENAYHCSKCLEKVPASKVLTLHTSPKVLILVLRRFSDLTGNKMTKEVQYPERLDMQHYLSEQRAGPLVYVLYAVLVHAGRS
CHSGHYFCFVKAGNGQWYKMDDAKVSACDVTCALRQPAYVLFYMQKTDLERDLGRESVEEGGLASPEADPTVVGEASGEPATDPSGNHPELEERGEETSRQQMTLDQWRC
LQECNRPKPELHVRRREIALPANAVILHHSKYRPEMPKNHPQPTVDLLTTAAGMLPPQVAGDMAKVPRVPGRARPTKRTSKKGQRSGEAVQGCVS*
114 >lcl|XP_851647.2|Plus1complement(15011194..15012801) NW_876262 ubiquitin carboxyl-terminal hydrolase 17-like protein 2-like LOC609310 __SEG__ Chr16 {Canis lupus familiaris} MEAAHLHPSEEPQFSASPKPQSCWSRRGGAEVHGGPSVPETTSPASKTLSSPTDLLAPASAGLPPTKTPLSWKSLSQVGAGLQNMGNTCYVNATLQCLTYTEPLASYMLS
QQHGTTCRRQTSCMLCTLQAHLTRVLCHPGRVLRPLPLLLAAFHRHKQEDAHEYLMFILDAMQQACLPEDKLSDPECPQDSTLIQQLFGGYWRSQIQCLHCQGISSTLEP
YLDISLDIGDAHSVSQALEQLVKPELLEGENAYHCSKCLEKVPASKVLTLHTSPKVLILVLRRFSNLTGNKMTKEVQYPERLDLQHYLSEQRAGPLVYVLYAVLVHAGRS
CHSGHYFCFIKAGNGQWYKMDDAKVSSCDVICALRQPAYVLFYMQKTDLERDLGRESVEEGGLASPEADPTVVGEASGEPATDPSVNHPELEERGEETSRQQMTLDQWRC
LQECNRPKPELNVRRREIALLANAVILHHSKYRPEMPKNHPQQTVDLLTSAAGMLPPQVAGDVAKVPRVPGRARPTKRMSKKGQMSGEAVQGCVS*
115 >lcl|XP_851691.1|Plus1complement(6539308..6540417) NW_876284 hsc70-interacting protein-like LOC609351 __SEG__ Chr27 {Canis lupus familiaris} MDPHKVSELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKIPPATHKTKSEDNVKEEKTDSKKAEENIKTDEPSSEESDLEIDNEGVIEPDTDAPQEMGDENVEITEEM
MDQANDKKVAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFIKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAM
LKEVQPRAQKIAEHRRKYERKREEQEIRERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPSNFPGGMPGMAGGMPGMAGMPGLNEILSDPEVLAAMQDPE
VMVAFQDVAQNPANMSKYQSNPKVMKLISKLSAKFGGQV*
116 >lcl|XP_851811.1|Plus1complement(2456327..2457028) NW_876271 dnaJ homolog subfamily B member 8 DNAJB8 __SEG__ Chr20 {Canis lupus familiaris} MANYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKQFKQVSEAYEVLSDTKRRSVYDRAGCDSWRAGGGASAPYGSPFDAGYTFRNPEDIFREFFGGLDPF
SFDFWDAPFNSDRAGRGPGLRGAFSAGFGEFPAFMEAFSAFDALGRAGGASRTTFSSTSFGGSGAGSSGFKSVMSSTEMVNGHKVTTKRIVENGQERMEVEEDGQLKSVT
INGKEQLKRVDNK*
117 >lcl|XP_852207.1|Plus133650271..33650579 NW_876327 10 kDa heat shock protein, mitochondrial-like LOC609748 __SEG__ Chr8 {Canis lupus familiaris} MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD*
118 >lcl|XP_853003.1|Plus122082550..22082987 NW_876284 ubiquitin-conjugating enzyme E2 variant 2-like UBE2V2 __SEG__ Chr27 {Canis lupus familiaris} MAVSTGVKVPCNFRLLEELEEGQKGVGDGTVSWGLEDNEDMTLTRWTGMIIGPPRTNYENRIYSLKVERGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQ
NSYSIKVVLQEQRRLMMSKENMKLPQPPEGQTYNN*
119 >lcl|XP_853726.1|Plus1complement(29948334..29948966) NW_876288 glutathione S-transferase P-like LOC487023 __SEG__ Chr29 {Canis lupus familiaris} MPPYTIIYFPVLGCYKAMHMLLVDQDQSWKEEVVTMETWMKGSLKASYLYGQLPKFQDRDVTLYQSSAILQHLGHSLGLYGKDHQEAALLDVVNDGVKDLRGKCALLIYT
NYEAGKEEYVKALPGYLKPFETLLSQNEGGQAFIMGNQIFFADYNLLDLLLIQQVLATRCLDSFSLLSVYVACLSTRPMLKVFLASPEHMNRPINGNGKQ*
120 >lcl|XP_853837.2|Plus116167599..16168708 NW_876266 hsc70-interacting protein-like LOC483608 __SEG__ Chr18 {Canis lupus familiaris} MDPRKVSELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKIPPATHKTKSEDNIKEEKTDSKKAEENIKTDEPSSEESDLEIDNEGVIEPDTDAPQEMGDENVEITEEM
MDQANDKKVAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFIKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAM
LKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAWEEHERAQREEEARRQSGAQYGSFPGGFPGGMPSNFPGGMPGMAGGMPGMAGMPGLNEILSDPEVPAAMQDPE
VMVAFQDVAQNPANMTKYQSNPKVMNLISKLSAKFGGQA*
121 >lcl|XP_854031.1|Plus120184182..20185789 NW_876262 ubiquitin carboxyl-terminal hydrolase 17-like LOC611292 __SEG__ Chr16 {Canis lupus familiaris} MEAAHLHPSEEPQFSASPKPQSCWSRRGGAEVHGGPSVPETTSPASKTLSSPTDPLAPASAGLPPTKTPLSWKSLSQVGAGLQNMGNTCYVNATLQCLTYTEPLASYMLS
QQHGTTCRRQTSCMLCTLQAHLTRVLCHPGRVLRPLPLLLAAFHRHKQEDAHEYLMFILDAMQQACLPEDKLSDPECPQDSTLIQQLFGGYWRSQIQCLHCQGISSTLEP
YLDISLDIGDAHSVSQALEQLMKPELLEGENAYHCSKCLEKVPASKVLTLHTSPKVLILVLRRFSDLTGNKMTKEVQYPERLDMQHCLSEQRAGPLVYVLYAVLVHTGRS
CHSGHYFCFVKAGNGQWYKMDDAKVSACDVTCALRQPAYVLFYMQKTDLERDLGRELVEEGGLASPEADPTVVGEASGEPATDPSVNLPELEECGEETSRQQMTLDQWRC
LQERNRPKLELNVRRREIALPANAVILHHSKYRPEMPKNHPQQTVDVLTTAAGMLPPQVAGDVAKVPRVPGRARPTKRMSKKGQRSGEAVQGCVS*
122 >lcl|XP_854129.2|Plus1complement(20263448..20265055) NW_876262 ubiquitin carboxyl-terminal hydrolase 17-like protein 2-like LOC611374 __SEG__ Chr16 {Canis lupus familiaris} MEAAHLHPSEEPQFSASPKPQSCWSRRGGAEVHGGPSVPETTSPASKTLSSPTDPLAPASAGLPPTKTPLSWKSLSQVGAGLQNMGNTCYVNATLQCLTYTEPLASYMLS
QQHGTTCRRQTSCMLCTLQAHLTRVLCHPGRVLRPLPLLLAAFHRHKQEDAHEYLMFILDAMQQACLPEDKLSDPERPQDSTLIQQLFEGYWRSQIQCLHCQGISSTLEP
YLDISLDIGDAHSVSQALEQLVKPELLEGENAYHCRKCLEKVPASKVLTLHTSPKVLILVLRRFSDLTGNKMTKEVQYPERLDMQHYLSEQRAGPLVYVLYAVLVHAGRS
CHSGHYFCFVKAGNGQWYKMDDAKVSACDVTCALRQPAYVLFYMQKTDLERDLGRESVKEGGLASPEADPTVVGEASGEPATDPSVNLPELEECGEETSRQQMTLDQWRC
LQECNRPKPELNVRRREIALPANAVILHHSKYRPEMQKNHPQQTVDLLTTAAGMLPPQVAGDVAKVPRVPGRARPTKRMSKKGQRSGEAVQGCVS*
123 >lcl|XP_854684.1|Plus1complement(42411155..42411946) NW_876253 proteasome subunit alpha type-1-like LOC613000 __SEG__ Chr11 {Canis lupus familiaris} MFRNQYDNDVTVWSPQGRIHQTEYAMEAVKQGPATVGLKSKTIAVLVALKRAQSELAAHQKKILHVDNHIGISIVGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVS
LIGSKTQIPTQRYVRRPYGVGLLIAGNDDMGPHIFQTCPSANYFDCRAMSIGAHSQSACTYLERHISGFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLE
FTIYDDDDVSPFLEGLEERPQRKAQPTQPADEPAEKADEPMEH*
124 >lcl|XP_856279.2|Plus14059407..4060729 NW_876302 26S protease regulatory subunit 4 isoform 3 PSMC1 __SEG__ Chr35 {Canis lupus familiaris} MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLKEKQEEERSTVDDLRGTPMSVG
TLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLELGCSVLLNHKVHAVIGVLMDDTDPLVIVMKVEKTPQETYADIRALDNQIQEIKESVELPLTHPEYYEEMGIKPPK
GVILYGPPGTGKTLLAKAVANQTSATFLRVVGSQLIQKYLGNGPKLIRELFRVVEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMA
TNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADAVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYRKQEGTPEGLYL
*
125 >lcl|XP_858453.2|Plus111480435..11480722 NW_876323 small ubiquitin-related modifier 2-like isoform 2 SUMO3 __SEG__ Chr7 {Canis lupus familiaris} MANEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLRKLTKAYCERQGLSMRQIRFRFDGQPINETDTPAQLAMEDEDTIDVFQQQTGGVY*
126 >lcl|XP_867775.2|Plus1complement(45752075..45752689) NW_876254 proteasome subunit beta type-3-like isoform 2 LOC474987 __SEG__ Chr12 {Canis lupus familiaris} MSIMSYNGGAVMAMKGKNCMAIAADRRFGIQAQMVTTDFQIFPMGDRLYIGLAGLATDVQAVAQCLKFRLNLYELKEGQQIKPYTLMSMVANLLYEKRFGPYYTEPVITG
LDPKTFKPFICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFENISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKAHMD*