SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau O    

ID / Description / Sequence
1 >lcl|NP_001014962.1|Plus1complement(1107977..1109104) NW_001494757 protein arginine N-methyltransferase 6 PRMT6 __SEG__ Chr3 {Bos taurus} MSQPKRRKLESGGGGEGGEGTEEEDGGELEVAVPRPRRTRRERDQLYYQCYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
VEASDIWQQAREVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGCGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQMLELRLSFWSQMKQLYGVDMS
CLESFATRCLMGHSEIVVQGLSGEDVLARPQCFARLELARAGLEQELEAGVGGRFRFSCYGSAPMHGFAIWFQVTFPGGDSEKPVVLSTSPFHPVTHWKQALLYLNEPVQ
VEQDTDVSGEITLLPSQDHHRHLRVLLRYKVGDQEEKTKDFAMED*
2 >lcl|NP_001029532.1|Plus11034001..1034279 NW_001494724 dolichyl-phosphate mannosyltransferase polypeptide 3 DPM3 __SEG__ Chr3 {Bos taurus} MTKLAQWLWALALLGSTWAALTMGALGLELPSSCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLTRRGLRF*
3 >lcl|NP_001030388.1|Plus1762114..762794 NW_001494707 ring finger protein 186 RNF186 __SEG__ Chr2 {Bos taurus} MACLEIPQQPQLVCQKATPSDPAGCDGGPGGPTEGDLECLVCREPYSGVRPPKLLGCQHAFCAVCLKLLLCVQDDAWSIPCPLCRKVTAVPGGLVCTLRDQEKVLERLAR
PGLEVPLRPQGLANPATLTAGQPREAGEEEQDAVTTNRAAARRLAAHLLLLVLLIILILPFIYPGVIRWVLSFLVTLALLLALLFCSHPGQQDGCMPTPRTLFCRERKPS
EIASIS*
4 >lcl|NP_001030499.1|Plus1complement(457536..458102) NW_001495496 ring finger protein 183 RNF183 __SEG__ Chr8 {Bos taurus} MAEQQGREPECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHISLVTPTRRRLLCPLCRHPTVLASGQPVTDLPTDTAVLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQ
PRVYTLDLGPEPASQAGQPQDVGPSTRPVPIRSRYSLRECFRNPHFRIFAYMMAVILCGTVLFIFSIFCTRRFFWGVG*
5 >lcl|NP_001035667.1|Plus1735939..736412 NW_001493678 heat shock protein beta-9 HSPB9 __SEG__ Chr19 {Bos taurus} MQRVGSSLPSGSQSASQCPSVAFTERNQVATLPVQRLTEDAAAVRDNVHTEDGFQMKLYAHGFTPEELLVQVNSGCLVVTGQRQLEGCNPDGTGFRVAQKVHQQMSLPPD
LDPAAMTCCLTPSGQLCVRGQCRALPPSEAQTGPASRFRSRGSKKLA*
6 >lcl|NP_001040035.1|Plus1complement(50082..50531) NW_001493941 heat shock protein beta-3 HSPB3 __SEG__ Chr20 {Bos taurus} MAKIILRHLIETPVRYEQEFEARGLEDCRLDHALYALPGPTTVDLGKARAAQAPPVDAAEMPPQRGESRFQVLLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFIS
RSFTRQYKLPDGIETKDLSAILCHDGILVVEVKDSAGTK*
7 >lcl|NP_001040075.1|Plus1complement(77074..78264) NW_001503121 RNA binding motif protein, X-linked RBMX __SEG__ Chr15 {Bos taurus} MVEADRPGKLFIGGLNLETDEKSLEATFGKYGRISEVLLMKDRETNKSRGFAFITFESPADAKAAVRDMNGKSLDGKAIKVAQATKPAFESGRRGPPLSRSRGRSRGLRG
ARGGGPRRPPSRGGPADDGGYAGDFDLRPSRAPLPMKRGPPPPRRAGPPPKRAAPSGPARSGSGGGMRGRAPAARGRDGYEGPPRRDPPPPRRDPYLGSREGGYSPRDGY
SSRDYSSARDARDFAPSPREYTYRDYGHSSARDECPSRGYGDRDGYGGRDRDYADHPSGGSYRDPFESYGDPRSAAPARGPPPSYGGGGGRYEEYRGCSPDAYGGGRDGY
AGGRSERYSGGRDRVGRADRGLPQSVERGCPPPRESYSRSGRKVPRGGGRLGSRSERGGGGGRSRY*
8 >lcl|NP_001069177.1|Plus1complement(2913393..2914430) NW_001494158 tubulin-specific chaperone C TBCC __SEG__ Chr23 {Bos taurus} METGGLSAAALANGDLGSQRERTLVPERLQKREHERQLEVERRKQKRQDQEVEEEKSDFFAAAFARERSAVEELLESGESVERLEEAAARLQGLQKLINDSVLFLAAYDL
RQAQEVLARLQAALAKRRQELQPKKRFAFKTRKKDAASATQVASAPDAPAAEGSLTSPPPLKEEGDFDSSWICGFSNLQSQVLEKRAEELHQQDVLLTQLRNCTIKLYGN
PNTLRLTKAQGCTLLCGPVSTSVFLEDCSDCVLAVACQQLRVHTTKDTRIFLQVTSRAIMEDCTGIQFAPYTWSYPGIDKDFEGSGLDKNKNNWNDVDDFNWLARDVASP
NWNVLPEEERRIQWD*
9 >lcl|NP_001069292.1|Plus12555204..2557165 NW_001495497 tripartite motif-containing 32 TRIM32 __SEG__ Chr8 {Bos taurus} MAAAAASHLNLDALREVLECPICLESFTEEQLRPKLLHCGHTICCRCLEKLLASSINGVRCPFCSKITLITSLAQLTDNLTVLKIIDKTGLSEAVGLLMCRSCGRRLPRQ
FCRSCGVVVCEPCREAEHPPPGHCTLPVKEAAEERRQDFGRKLARLRELTGELQRRKVALEGVSKDLQARYKAVLQEYGHEERRVQEELARSRKFFTGSVAEVEKSNSQL
VEEQSYLLNVAEVQAVSRCDYFLAKIKQADVALLEEAADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRTVNMEDSWAMEAAASAAPSSVTFREMDVSPE
DMGASPRASPAKQRGSDPATNIQQCLFLRKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSSSAMDSFVLSFFGADPPNLTPLSVAMNCHG
LIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGAGVVKYSCLCSAVRPKFVACDAEGTVYFTQGLGLNLENWQNEHHLEGGF
SIGSVGPDGQLGRQISHFFSENEDFRCITGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP*
10 >lcl|NP_001069380.1|Plus1complement(2694758..2695504) NW_001494698 stratifin SFN __SEG__ Chr2 {Bos taurus} MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEESSEEKGPEVQEYREKVETELRGVCDTVLGLLDTHLIKE
AGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIM
QLLRDNLTLWTADNAGEEGGEAPEEPQS*
11 >lcl|NP_001069384.1|Plus1complement(951972..952706) NW_003101169 hypothetical protein LOC528549 LOC528549 __SEG__ Chr3 {Bos taurus} MVDYYEVLGVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAQAYEVLSDAKKRDVYDRYGEAGVEGGGGGRAGGGRPFEDPFECIFTFRDPADVFREFFGS
RDPFSFDFFGDPLENFVGGRRRSRGSRSRGSASLFSAFSEFPPFGSGFSPFDTGFTSFGSIGNGGLSSVSMSRGSGGTGNFKSMSTSTEIMNGKMITTKRIVENGQERIE
VEEDGELKSLIINGKEQLLSTDTK*
12 >lcl|NP_001069590.1|Plus1complement(1236191..1237129) NW_001495239 heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1 HS3ST1 __SEG__ Chr6 {Bos taurus} MAPLLLGAVMLVAQLQLVPSRPAVVPGDEPGLPELVRKAAALQEEISDGAAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGLGWYLS
QMPFSAPHQLTVEKTPAYFTSPKVPERVHGMNPAIRLLLILRDPSERVLSDYTQVFYNHVQKRKPYPSIEEFLVRDGRLNVDYKALNRSLYHLHMQNWLRFFPLRRIHIV
DGDRLIRDPFPEIQKVERFLRLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPRLLNKLHEYFHEPNKKFFELVGRTFDWH*
13 >lcl|NP_001071406.1|Plus1complement(2834783..2835532) NW_001494184 ring finger protein 182 RNF182 __SEG__ Chr23 {Bos taurus} MASQLPEEAAKSQVSDELECKICYNRYNLKQRKPKVLGCCHRVCAKCLCKIINFGDTPHGVIVCPFCRFETCLPDDEVSSLPDDNNILLNLTCGGGKGKKCLPENPTELL
LTPKRLASLVSPSHASSNCLVITIMEVQRESSPSLSSTPVVEFYRPSSFDSVTTAVSHNWTMWNCTSLVFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSL
VPSSLVILMVYGFCQCVCHEFLDCLAPSS*
14 >lcl|NP_001071437.1|Plus1382848..383174 NW_001492919 FK506-binding protein 1A-like LOC526524 __SEG__ Chr11 {Bos taurus} MGVQVETISPGDGRTFPKHGQTCVVHYTGTLEDGKKFDSSRDRNKPFKFVLGKKQVIRGWEEGIAQMSIGQRAKLTVSPDYAYGSRGHPGIIPPNATLIFDVELLKLE*
15 >lcl|NP_001073067.1|Plus1197448..198089 NW_001508823 hypothetical protein LOC520057 LOC520057 __SEG__ ChrX {Bos taurus} MSASTSSRRPIKGILKNKGSTASSVAGSAQQSGGPLQEVHRKKSQKWDESNILATYRPEYRDYDFMKMNEPSTPQFGPQNLGERSAESEATALDSLTKRLAATHTSDSSY
SVRDPELDGAHSSKIYLDRQEKRRQFEMKRKLHYSEGKNIKLARQLISRDLLHDYEDDNNEESSHVISHDKTTTQEEAEQGATSDEGLQTQTCCYLGDDEDDK*
16 >lcl|NP_001073112.1|Plus1complement(219173..219760) NW_001494783 dnaj-like protein LOC780805 __SEG__ Chr3 {Bos taurus} MVNYYKVLGVPQNASSSDIKKAYHQLALQVHPDKNSENREAAEEKFKQIAEAYAVLSDAKKRDNYDNTRRHCIKRENRGDGRDKDYLKEELRFARPRCDFQSIFEDQDFF
SGGCFPTDSVGGARRFRPSFFDVTPIPDTGFSTFVSVGSGPNSPSSRTFVPFISSGMGNFKLVTTYSQTVNGKKVVIKKVLENVS*
17 >lcl|NP_001073779.1|Plus1401401..402486 NW_001493731 tripartite motif-containing 59 TRIM59 __SEG__ Chr1 {Bos taurus} MHNFEDELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQATGNFYIWRPLRIPLKCPNCRSIIEIAPSGIESLPVNFALRAIIEKYQQEDHPDIITCPEHYRQPLNVYCL
LDKKLVCGHCLTIGQHHGHPIDDLQSAYMKEKDTPQKLLEQLTDTHWTDLTCLIEKLEEQKSHSEKMVQGDKEVVLQYFKELSDTLEQKKKIFLTALCDVGNLINQEYTP
QIERMKEIREQQLELVTLTTSLQEEAPLKFLEKVDDVRQRVHILKQRPLPNVQPVEIYPRVSQVLKEDWSRTEIGQIKKLLIPEMKISSKRIPCAWPDKEEKVEFFKILN
IVIVTLISVILMLILFFNQHIITFLNEITSIC
18 >lcl|NP_001074386.1|Plus128674..29240 NW_001494318 DnaJ (Hsp40) homolog subfamily C member 30 DNAJC30 __SEG__ Chr25 {Bos taurus} MAARRDLKWSQLLLWRLWQPRGVPQNPRSGLGPEARTYTRSDGPYSRTALYDLLGVPSTATQAQIKAAYYRQSFLYHPDRNSGSAEAAERFTRISQAYVVLGSTTLRRKY
DRGLLSDEDLRGPGVRPSKTPAADPETPRTPPPGPRAHGRGPASPGAKRTMFDFDAFYQAHYGEQLERERRLRRAGRLP
19 >lcl|NP_001092856.1|Plus1complement(654832..655701) NW_001492802 proteasome beta 11 subunit PSMB11 __SEG__ Chr10 {Bos taurus} MALQDVCKWQAPDTQETSPHLPQAGSWAVPRGWDPQAFLQTHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGNYVECPASRKVIPVHQHLLGTTSGTSADCVTWYRVLQR
ELRLRALREGQLPSVAGAAKLLSVMMSRYRGLDLCVATALCGWDRSGPALFYVYSDGTCLQGNIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATRRDAYSG
GSVDLFHVRESGWEYVSRHDAWVLYSELQKLPGPEKEWEEEATPDRAGEGREPSVGLAPGDLKVPTERL*
20 >lcl|NP_001093200.1|Plus1complement(1132409..1133323) NW_001495111 DnaJ (Hsp40) homolog, subfamily B, member 7 DNAJB7 __SEG__ Chr5 {Bos taurus} MVDYYQVLGLERHASPEDIKKAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSHDEKRDIYDKYGKEGLNGGGGSDFDDSSEYGFTFRKPDDVFKEIFGDRDPFSF
HFFEDSLEDLLNNSRSSYGSRNRGARSFFSTSSEYPVFERFSSYDIGYTPFGSLGHEGLYSFSSLAFDGSGMDNYITVTTSGKIVNGRNTNTKRITEDDLERDEDDGELK
SFLLNGVADEEGFAEEYCWRRQSFNNYSPKSCSPKHANNDEQGITWVTSNWNPSIFSAGFKEGGTRKKKKHKEVQKKKSTKRNR*
21 >lcl|NP_001093818.1|Plus1complement(1688454..1689371) NW_001493221 peroxin 2 PEX2 __SEG__ Chr14 {Bos taurus} MASGDENAERTNRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFLWLFLWRFTIYSKNATVGQSVLNIQYQNDLSPNLSYQPPSRNQKLWYAVCT
IGGKWLEERCYDLFRNRHIASFRKAKQCMNLVVGLLKLGGLINFLIFLQRGKFATLTERLLGIHSVFHKPQSVREVGFEYMNRELLWHGFAEFLIFLLPLINVQKLRAKL
SSWCVPLTGAPGSNSTLATSGRQCSLCGEWPTMPHTVGCEHVFCYYCVKSSFLFDMSFTCPKCGTEVHSLQPLKSGIEMAEVSVP*
22 >lcl|NP_001093845.1|Plus1283649..285775 NW_001495237 Bardet-Biedl syndrome 12 BBS12 __SEG__ Chr17 {Bos taurus} MDCRVINRRRHTGLQQLSSFAETGRTFLGPVKSSKFIIDEECHESVLISSTVRLLESLDLTSAVGQLLNEAIQAQNSTYRTGTSTLLFLVGAWSSAAEECLHLGVPMSLI
ASVMSEGLNSCIEEVESLQVPIHSVCDHIDSTETFSGLSVSLYPSLQIPSGTGLVQKEHDLKDVTSQSLAFCSLSGRPVKSPQLFRLQAKFEADENISRTPQTLKNNLLA
DTHCRKSVLTHSRHFSRTDRHWISKPRGFLEQLSAAAPKTYSCSNLAELEVGLSHGDPSSMRLVDEAVRLQHQNAGRQRGSHTGLFPFDISRIFTCCLPGLPDTLSCVCP
GYITVVSMSTATLVKELQNQPVRVVLVEGDLTENYRHLGFNKPANIKTVSESVKVQQDSSEELWTDHVLQVLIKFNVNLVLARGNVSERLAEKCTDSKQLVIGSVQDSVL
QAFAEASGAVQVAYLTHMNENCVGSGVSVTTWRSIPSDTIDGISRMAVVLKTEGINLVTVVLTSPVIAQMQTKEDRFWTCASRLYYALKEQKVFLGGGAVEILCLTHLQS
LAGQSVNKGNQDCSGWLHNTSSWLASSAALYRPTVLKCLADGWHRYLSTLLRNTAVYSSDSEAATSIQCHLQNAADSGSPSSYILNEYSKLNSVILNLGISDKLEPIPRV
YDVVTPKIEAWRRALDLVLLVLQTDNEIITGLAHTQKSSQESEGFLFL*
23 >lcl|NP_001095991.1|Plus1complement(2075469..2077295) NW_001495468 hypothetical protein LOC539818 MGC152360 __SEG__ Chr8 {Bos taurus} MEAPAVHLLPLLLLFAAWAPEPGSTSAEALPLVNEEVRRTVDLSSHLAKVTAEVVLAHTGSDSSPRAASFLVALEPEFEAQLAHLGVQVTGVDEEANSLEVQETKINGKS
GRFFTVQLPVALDPGAEVSVVVEAVYTHAIQPYPIQITQSQKQFVVFEGNHYFYSPYPTKTQTMHVKLASPNVESYTKLGNPMRHENLLDYGPFHDIPAYSQDSFKVHSE
NNSPFLTVTSMTRVIEVSHWGNIAVEENVNLKHTGAVLKGSFSRYDYDKWIDSGISSIRSFKTILPASAQDVYYRDEIGSIYTRHLLILDDSVEMEMKPRFPLFGGWKTH
YIIGYNLPSYEYLYNLGDQYVLKMRLVDHVFDKQVIDSLTVKIILPEGARNIQVDSPYEISRAPDKLYYTYLDTFGRPVIVAHKKNLVEQHIQDIMVHYTFSKVLMLQEP
LLLVATFSILFFTVVIYVRLDLSITKDPAAEARMKVACIIEQVLTLVSKRLGLYHHFNKTVNRYKQSRDVSVLNSGKKSLEMEHKALTSEVALLQARLKTEGSNLCDKVS
EMQKLDTQVKQLVLKSAVEAEWLVAGKLKKDMYIQNKKLISGKRQELVSKIEHILDTL*
24 >lcl|NP_001096717.1|Plus1complement(970820..971674) NW_001494415 protein phosphatase 1 regulatory subunit 3B PPP1R3B __SEG__ Chr27 {Bos taurus} MAVDIECRYSCMAPSLRRERFAFQIAPKPSKPLRPCIQLSGKNEASGTVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPLNITELLDSIVSLTTAESESFV
LDFSQPSADYLDFRNRLQTDHVCLENCVLKDRSIAGTVKVQNLAFEKTVKVRMTFDTWKSFTDFPCWYVKDTYAGSDKDTFSFDISLPEKIQSYERMEFAVCYECNGQTY
WDSNKGKNYRIIRAELQSTQGTAQPPNGPDFEIAFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY*
25 >lcl|NP_001096791.1|Plus1complement(72247..73983) NW_001495002 polypeptide N-acetylgalactosaminyltransferase 4 GALNT4 __SEG__ Chr5 {Bos taurus} MAVRWTWARRSCLLLALLTVAYLLVELSVSTLHASLRAGGAREPGSRQLSEPGKKAVDLSRPLYEKPPADSHALGEWGKASKLQLSESELKQQEELIERYAINIYLSDRI
SLHRHIEDKRMYECKSKKFNYRRLPTTSVIIAFYNEAWSTLLRTIHSVLETSPAVLLKEIILVDDLSDRVYLKTQLETYVSNLDRVRLIRTNKREGLVRARLIGATFATG
DVLTFLDCHCECNTGWLEPLLERIRKDETVVICPVIDTIDWNTFEFYMQTGEPMIGGFDWRLTFQWHSVPKHERDRRKSRIEPFRSPTMAGGLFAVSKKYFQYLGTYDTG
MEVWGGENLELSFRVWQCGGKLEIHPCSHVGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDISERKLLRERLRCKSFDWYLKNVFSTLHVPED
RPGWHGAIRSIGISSECLDYNAPDNNPTSANLSLFGCHGQGGNQFFEYTSNKEIRFNSVTELCAEVPELKKHVGMQNCPKDGFPIPANIIWHFKEDGTVFHPHSGLCLSA
FRTQEGGPDVQMRTCNALDKNQIWKFET*
26 >lcl|NP_001138547.1|Plus1complement(386645..387961) NW_001508799 X-linked ubiquitin thioesterase 27 USP27X __SEG__ ChrX {Bos taurus} MCKDYVYDRDIEQIAKEEQGEALKLQASTSTEVSHQQYSVPGLGEKYPTWETTKPELELLGHNPRRRRIASSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDR
HRCEMPSPELCLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDAGKAASNPNHCNCIIDQIFTGGLQSDVTCQACHGVS
TTIDPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMNKLPVVACFHFKRFEHSAKQRRKITTYISFP
LELDMTPFMASSKESRMNGQLQLPTNSGNDENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHKQVLEHESEKVKEVNTQAY*
27 >lcl|NP_001161367.1|Plus1318488..320413 NW_001494172 heat shock 70kDa protein 1-like HSPA1L __SEG__ Chr23 {Bos taurus} MAAAKGTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEGGKPKVMVSYK
GEKKAFYPEEISSMVLTKMKETAEAFLGYTVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKAGQGERHVLIFDLGGGTFDVSVLTIDDGIFE
VKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDK
AKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGV
LIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFN
MKSAVSDEGLQGKISESDKKKILSKCNEVLLWLEANQLAEKDEFDHKRKELEQVCNPIITKLYQGGCTGPSCGTGYTPGRAATGPTIEEVD*
28 >lcl|NP_776769.1|Plus12577786..2579696 NW_001492860 heat shock-related 70 kDa protein 2 HSPA2 __SEG__ Chr10 {Bos taurus} MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKG
EIKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIF
EVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIAPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLD
KGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSS
VLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTY
NIKQTVEDEKLRGKISDQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGGSGASGGPTIEEVD*
29 >lcl|NP_776917.2|Plus1<1..654 NW_001493549 14-3-3 protein eta YWHAH __SEG__ Chr17 {Bos taurus} VTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVAS
GEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN*
30 >lcl|NP_777218.2|Plus1complement(901958..>902614) NW_001494318 14-3-3 protein gamma YWHAG __SEG__ Chr25 {Bos taurus} VTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVAT
GEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN*
31 >lcl|NP_976067.2|Plus1complement(301713..303638) NW_001494172 heat shock 70kDa protein 1B HSPA1B __SEG__ Chr23 {Bos taurus} MAKNMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVINDGDKPKVQVSYKGE
TKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVK
ATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ
IHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLI
QVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK
SAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISRLYQGAGGPGAGGFGAQGPKGGSGSGPTIEEVD*
32 >lcl|XP_001250252.1|Plus1complement(109946..111136) NW_001493322 heterogeneous nuclear ribonucleoprotein G-like LOC782306 __SEG__ Chr15 {Bos taurus} MVEADRPGKLFIGGLNLETDEKSLEATFGKYGRISEVLLMKDRETNKSRGFAFITFESPADAKAAVRDMNGKSLDGKAIKVAQATKPAFESGRRGPPLSRSRGRSRGLRG
ARGGGPRRPPSRGGPADDGGYAGDFDLRPSRAPLPMKRGPPPPRRAGPPPKRAAPSGPARSGSGGGMRGRAPAARGRDGYEGPPRRDPPPPRRDPYLGSREGGYSPRDGY
SSRDYSSARDARDFAPSPREYTYRDYGHSSARDECPSRGYGDRDGYGGRDRDYADHPSGGSYRDPFESYGDPRSAAPARGPPPSYGGGGGRYEEYRGCSPDAYGGGRDGY
AGGRSERYSGGRDRVGRADRGLPQSVERGCPPPRESYSRSGRKVPRGGGRLGSRSERGGGGGRSRY*
33 >lcl|XP_001250297.1|Plus1312624..313523 NW_001493152 protein phosphatase 1, regulatory subunit 3D PPP1R3D __SEG__ Chr13 {Bos taurus} MSGGPGSAVLPATVGFRKPAPRSLSCLSDLDGGAAREPRPCRPPGSPGSAPPPPPAPSGCDPHLRPIILRRARSLPSSPERRQKGAGAPGAACRPGCSRQHRVRFADALG
LELAQVKVFNAGEDPSVPLHVLSRLAINSDLCCSSQDLEFTLQCLVPDFPPPVEAPDFGERLGRQLVCLERVTCSDLGISGTVRVRNVAFEKQVAVRYTFSDWRSAHEVA
ARWRGPAGSGGSEDVFAFGFPVPPFLLELGSRVHFALRYRVAGAEHWDNNDGRDYSLTCRNHALHMPRGECEESWIHFI*
34 >lcl|XP_001250317.1|Plus115737..16681 NW_001502063 ring finger protein 126-like LOC782676 __SEG__ Chr6 {Bos taurus} MAEASPQPGRYFCHCCSVEIVPRLPDYICPRCGSGFIEELPEENRSAENGSAPSTASADQSRQQPFENVDQPLFTLPQGYGHFAFGIFDDSFEIPTFPAGAQADDSRDPE
SRREREQDSWHPYGPRQPCARLTARRATGRHEGDPTLEGIIQQLVNGIITPATIPNLGLGPWDVLHSNPMDYTWGANSLDAIITQLLNQFENSGPPPADKEKIQALPTVP
VTEEHVGSGLECPVCKDDYGLGEHVRQLPCNHFFHNGCIVPWLEQHDSCPVCRKSLTGQNTATDPPGLAVVSFSSSSSSSSSSSPGNENPASSS*
35 >lcl|XP_001250328.1|Plus1complement(145481..145801) NW_001508844 glutaredoxin (thioltransferase)-like LOC783653 __SEG__ ChrX {Bos taurus} MAQAFVNSKIQPGKVVVFIKPTCPYCRKTQELLSQLPFKQGLLEFVGITAAGNTSEIQDYLQQLTRARTVPQVFIGQECIGGCTDLVNMHERGELLTRLKQIGALQ*
36 >lcl|XP_001250362.1|Plus1254324..254716 NW_001501799 ubiquitin-like protein fubi and ribosomal protein S30 isoform 1 LOC783726 __SEG__ Chr5 {Bos taurus} MQLFVRAQELHTLEVTGQETVAQIKAHVASLEGIAPEDQVLLLAGSPLEDEATLGQCGVEALSTVEVAGRMLRGKVHGSLAHAGKVRGQTPKVAKQEKKTGRAKRRMQYN
RRFVNVVPTFGKKKGPNANS*
37 >lcl|XP_001250373.1|Plus1160451..160771 NW_001508844 glutaredoxin (thioltransferase)-like LOC783689 __SEG__ ChrX {Bos taurus} MAQAFVNSKIQPGKVVVFIKPTCPYCRKTQELLSQLPFKQGLLEFVDITAAGNTSEIQDYLQQLTGARTVPRVFIGQECIGGCTDLVNTHERGELLTRLKQIGALQ*
38 >lcl|XP_001250460.1|Plus1250491..251435 NW_001502063 ring finger protein 126-like LOC782858 __SEG__ Chr6 {Bos taurus} MAEASPQPGRYFCHCCSVEIVPRLPDYICPRCGSGFIEELPEENRSAENGSAPSTASADQSRQQPFENVDQPLFTLPQGYGHFAFGIFDDSFEIPTFPAGAQADDSRDPE
SRREREQDSWHPYGPRQPCARLTARRATGRHEGDPTLEGIIQQLVNGIITPATIPNLGLGPWDVLHSNPMDYTWGANSLDAIITQLLNQFENSGPPPADKEKIQALPTVP
VTEEHVGSGLECPVCKDDYGLGEHVRQLPCNHFFHNGCIVPWLEQHDSCPVCRKSLTGQNTATDPPGLAVVSFSSSSSSSSSSSPGNENPASSS*
39 >lcl|XP_001250667.1|Plus11220702..1221490 NW_001493671 FUS interacting protein (serine-arginine rich) 1 FUSIP1 __SEG__ Chr19 {Bos taurus} MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKCICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRY
DDYDRYRRSRSQSYDRRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSG
SRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH*
40 >lcl|XP_001250692.2|Plus1complement(247128..248480) NW_001492979 COP9 constitutive photomorphogenic homolog subunit 2 COPS2 __SEG__ Chr11 {Bos taurus} MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEK
SINSILDYISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKK
LKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDI
TEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNS
LNQAVVSKLA*
41 >lcl|XP_001251133.1|Plus1complement(288942..289262) NW_001502544 glutaredoxin (thioltransferase)-like GLRX __SEG__ Chr18 {Bos taurus} MAQTFVNSKIQSGKVVVFIKPTCPYCKRTPELLNQLPFKQGLLEFVSITANSDTNEIQDYLQQLTGARTVPRVFVGKECIGGCTDLVNIHERGELLTRIKQIEALQ*
42 >lcl|XP_001251776.1|Plus1complement(2038120..2038635) NW_001492801 tetratricopeptide repeat domain 9C-like LOC784873 __SEG__ Chr10 {Bos taurus} MEKRLQEAQLYKEKGNQCYREGKYRDAVSGYHRALLQLWGLNPSLPSPIPNLGPQGSALTPEQENLLHTTQTDCYNNLAACLLQMEPVNYERVKEYSQKVLERQPDNAKA
LYRAGVAFFHLQDYDQARHYLMAAVNRKPKDANVRRYLQRTQLELSSYHGKEKQLYLGMFG*
43 >lcl|XP_001251874.1|Plus1complement(2580438..2582864) NW_001493536 fertilin alpha-like LOC783232 __SEG__ Chr17 {Bos taurus} MSVAASVRDSASVLPSLWKRQLALSEAIRVLQTWAPHMKGLRLALVPGLSCARLGILLFLVLISLPSLYCDLGSPYHSSYEVVIPKSLTVEGREDQVEKLSYVLFMQGQR
QLIHLTLKTDYFVDNFPVFSYHDGILGQEMPLISRDCHYEGYIEGVPGSFVSVNTCSGLRGLLIKEGKSYGLEPVHSSKRFEHLLYAMAHEARVSCGVTSKDSQVASTSR
RPESGKPHSWQVPSDLWSHTKYVEMFVVVNNQRFQMWGSDVNQTVQRVMDIIALANSFTRGINTEVVLAGMEIWTEGDLTEVPVDLQVALRNFNSWRQEKLFHRVKHDVA
HMIVGQHPREDTGQAFLSGACSSDFAAAVESFHHEDVLLFAALMVHELGHNLGIQHDHPACMCKDRPFCLMRENITKESGFSNCSSDFFHRFLWEHKGACLFNKPGHKGR
LRRASRCGDGIVEGPEQCDCGSNCERHPCCDTRCQLREHAECSDGLCCDKCRLRYQGFMCRAALGECDLPEYCNGSSGECPRDSYKLDGTMCDRIHYCAGGRCKNPDNQC
MDIYGSPARSAPEMCYVSMNTRGDRFGNCGTTSSPRLTYLKCADDNIFCGKLICTNVREIPQLKPNQTLIQVAHKDDWCWSMDAYGTADVPDDGDAHTGTLCAPHKVCMN
HLCTDYTSLGYNCETTELCNGKGVCNNFRHCHCEDGYAPPDCKTPGNGGSVDSGSSGKPRDSIDNNPSEEESKSHDSEVVNFHRNSENKDESQSLDKILYIVPLFLLAIF
LALVIAASFRARKDMSQCSQEDLEESEEEAVQIEEAVR*
44 >lcl|XP_001252307.1|Plus13668392..3668706 NW_001493312 small ubiquitin-related modifier 3-like SUMO3 __SEG__ Chr15 {Bos taurus} MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMENEDTIDMFQQQMGGSRVASCLLGSGL*
45 >lcl|XP_001252498.1|Plus1219343..219837 NW_001492803 TRIM5/cyclophilin A fusion protein-like isoform 1 PPIA __SEG__ Chr10 {Bos taurus} MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGS
QFFICTAKTEWLDGKHVVFGKVKEGMNTVEAMERFGSRNGKTSKNITIADCGQI*
46 >lcl|XP_001252922.1|Plus1complement(744540..745070) NW_001494641 TRIMCyp-like LOC784679 __SEG__ Chr2 {Bos taurus} MLPPWSLLSCPATVNPIFFFDIAVDSKPLGHVSFELFADEVPKTEENFHAQSTGEKGFGYKVSCFHRIVLGLMCQGGDFTCHNGTGGKSIYGKKFYDENFILKHTGPGTL
SMVNAGPNTNSSQFFICTAKTEWLDGMYVVFGKVKEGMDIVEAMECFGSRNGKTSKRITISDCGKI*
47 >lcl|XP_001253172.1|Plus11678329..1678649 NW_001493441 glutaredoxin (thioltransferase)-like LOC786967 __SEG__ Chr16 {Bos taurus} MAQAFVNSKIQPGKVVVFIKPTCPYCRKTQELLSQLPFKQGLLEFVDITAAGNTSEIQDYLQQLTGARTVPRVFIGQECIGGCTDLVNTHERGELLTRLKQIGALQ*
48 >lcl|XP_001253575.1|Plus1complement(199070..199585) NW_001508783 zinc finger protein 9 LOC785599 __SEG__ ChrX {Bos taurus} MSSKECFKCGRVGHWAPACSKGGGARGRGARGRGHGAQCSSTTLPVICYRCGKFGHYAKDCDLLDDICYNCGKSGHIAKDCAEPKREGERCCYTCGRPGHLARDCDRQEE
RKCYSCGKSGHIQKYCTQVKCYRCGEIGHVAINCRKMNEVNCYRCGESGHLTRECPIEANT*
49 >lcl|XP_001253764.2|Plus1complement(2114564..2114869) NW_001492809 SMT3 suppressor of mif two 3 homolog 1 SUMO1 __SEG__ Chr10 {Bos taurus} MSDQEAKPSTKDLGDKKEEEYIKLKVIRQDSSESHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV*
50 >lcl|XP_001254703.1|Plus1complement(552643..553074) NW_001493821 ring finger protein 11-like LOC787246 __SEG__ Chr1 {Bos taurus} MGNCIGSSTGDDRPVARFPAPLRERRGGDGPGAGGPRGPERRGAGAAPPGAPLTFRRRIRLIQSPPRDVYGRDGCETKTTECAVCLMDLVPGDLIRPLPCKHVYHLDCIN
QWLTRSFTCPLCRGPADAAQPLFEDALEPRPLV*
51 >lcl|XP_001256105.1|Plus117217..19361 NW_001494740 ADAM metallopeptidase domain 30 LOC789317 __SEG__ Chr3 {Bos taurus} MRSVRTCLSPGRSLVLAVLLVDSLGKDLLFHPEWGFDSYEITIPKKLSFRGGERRVARHVSYLLQVKGKDRVLHLWPKRFLLPRNLQIFSFTEQGRLLEDHPYISSDCNY
MGLVEGNPESEATISTCMGGLRGILKIAASNYQIEPFKASSNFEHMVYPLEKEEEIPNQICGLTNEETVEQMAQHENMARTPDFTESYVHQKYLELALVFDNSRYLYMNS
NLTQIINDAILLTSIADSYFQDVHMRIQLLAVEVWTDRDKIALNSPELSQVLGQFVKYRSRDLRVRIPADWAHLYVHKKFKDALAHHWGSVCSMMPSGSTSSVLDRNILG
PATWTAHVLGHSVGMTHDYEYCQCKGRHSCIMGTGRTGFSNCSYAEFYSHVNSGLNCLNNLPGLGYVVKRCGNKIVEENEECDCGSTEECKEDRCCQPDCKFKQGASCNI
GLCCHNCRFRPSGYMCRVEENECDLAEYCNGTSAFCPSDTYKQDGTPCKYEAHCFKQSCQSRYMQCQKIFGLDAKDAPHQCYDAVNVIGDQYGNCGIIGVREYKKCPKER
SLCGRLQCINVETLPDMPDHTILISTHLHKENLMCWGIGYHLAMVPMGLPDLGVINDGTSCGKERVCFNRNCVNSSILNFDCFPEKCNRRGVCNSNRNCHCMYGWAPPLC
EEVGYGGSIDSGPPGPVKEGVPVSVQVVSLMVMRLIFLFISVILVLFWNVLEHI*
52 >lcl|XP_001256113.1|Plus1389173..390774 NW_001494132 deubiquitinating enzyme 1-like LOC789329 __SEG__ Chr3 {Bos taurus} METLVGLVCRAPGAASEHGGGVCPSPFDVFPGGQGCGPSAAGADALRGPSVPEGPSPALGRPQRGDLAPGSAGLTPGQKGALSWKGPWGVGAGLQNLGNTCYVNAALQCL
SHTPPLASWMVSQQHATLCPARSACTLCAMRAHVTRALLHAGEVIRPRKDLLAGFHRHQQEDAHEFLMFTLNAMQQGCLSASQPSGHASEDTTVIRQIFGGTWRSQIQCL
RCLGVSDTFDPYLDISLDITAAQSVEQALRELVKPEKLDADNAYDCGVCLRKVPATKRLTLHSTSQVLVLVLKRFTPVSGAKRAQEVRYPQCLDLQPYTSERKAGPLGYV
LYAVLVHSGWSCERGHYFCYVRAGNGQWYKMDDAKVTACDETAALSQSAYVLFYAREGAWEGGAGGGAAAPVGADPTEPGQPAGDASGRAPGSEESPGDTEVEGMSLEQW
RRLQEHSRPKPALELRKVQSALPAGAVVIHQSKHGGGRNRTPPQQEHERLDRPSTDTPPPGPKNVGNGPCAGGRARATKGKNKKPRPSLGLWR*
53 >lcl|XP_001256117.1|Plus152727..54898 NW_001494740 ADAM metallopeptidase domain 30 ADAM30 __SEG__ Chr3 {Bos taurus} MRSVRTCLSPGRSLVLAVLLVDSLGKDLHFHPEWGFDSYEITIPKKLSFRGREQRAARHVSYLLKVKGRNRVVHLWPKRFLLPRNLQVFSFTEQGRLLEDHPYIPSDCNY
MGLVEGNPDSQATISTCMGGLRGILKIDANHYQIEPRKASSQFEHVVYLLEKEEEFPNQICGLTNDETVEQMAQHENMARTPDFTESYPHQKYLELALVFDNSRYLYLNS
NLTQIINDAILLTSIADSYFQDVRMRIQLLAVEVWTDRDKIRLNFGQLSQVLGQFVKYRTSDLRVRIPADWAHLYVHKKFKDALAHHWGSVCSMMPSGSTSSVLDRNILG
PATWTAHVLGHSVGMTHDYEYCQCKGRHSCIMGTGRTGFSNCSYAEFYSHVNSGLNCLNNLPGLGYVVKRCGNKIVEENEECDCGSGEECEEDGCCQPDCKFKEGANCST
GLCCHKCQFRPSGYMCRVEENECDLAEYCNGTSAFCPSDTYKQDGTPCKYRSRCVRKGCQSRTMQCQNIFGADALGAPHQCYDAVNVIGDQYGNCGILGVREYKKCPKER
SLCGRLQCINVETLPDMPDHTILISTHLHKENLMCWGIGYHLAMVPMGLRDLGVINDGTSCGKERVCFNRNCVNSSILNFDCFPEKCNRRGVCNSNRNCHCMYGWAPPLC
EEVGYGGSIDSGPPGPLRKNMPISLQVVILILMRLIFLIISVIVVFYRKNHRNLIQRERNTTL*
54 >lcl|XP_001256496.1|Plus1complement(1408467..1408721) NW_001493579 peptidylprolyl isomerase H-like LOC789870 __SEG__ Chr18 {Bos taurus} MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDLKKINK*
55 >lcl|XP_001256664.2|Plus1complement(3861900..3863573) NW_001493616 interferon regulatory factor 2 binding protein 1 IRF2BP1 __SEG__ Chr18 {Bos taurus} MASVQASRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHVLPEGRSPGPPALKHPATKDLAAAAAQGPQLPPPQAQPQPSGTGGAVSXXX
XXXXXXXXXXXXXXRALLGSMPGLVLPGLLAAAVSALGSRGLTLAPGLSPARPAFGSDFEKEKQQRNADCLAELNEAMRGRAEERHGRPKAVREQLLALSACAPFNVRFK
KDHGLVGRVFAFDATARPPGYEFELKLFTEYPCGSGNVYAGVLAVAHQMFHDALREPGKALASSGFKYLEYERRHGSGEWRQLGELLTDGVRSFREPAPAEALPQQYPEP
APAALCGPPPRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPFSADTPGVPSPIAALKNVAEALGHSPKDPAGSGGPVRAGGASPAASSTAPPPAQHR
LVARNGEAEVSPTAGAEAVSGGGSGARATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGDKCPLVGSSVPWAFMQGEIATILAGDIK
VKKERDP*
56 >lcl|XP_001788011.1|Plus1500407..500709 NW_001495600 DnaJ subfamily A member 2-like LOC530283 __SEG__ Chr9 {Bos taurus} MANVADTKLYDHLGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMKKKEKKKKQHLFLIKE*
57 >lcl|XP_001788024.1|Plus1complement(187512..188216) NW_001493867 proteasome alpha 2 subunit LOC781156 __SEG__ Chr1 {Bos taurus} MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQL
VQRVASVMQEYTQSCGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRR
LTPTEVKDYLAAIA*
58 >lcl|XP_001788124.1|Plus1<88817..89353 NW_001494309 heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2-like LOC782286 __SEG__ Chr25 {Bos taurus} QFPLALQEPPGAAEPPPPSLPPPPVRLGAPSQPPAPPPPDNASRGEPPEPPRQPAAPGADGWGLASGSGGARDAWLRTPLTPGEMVTAQSALVEREAPESSTTDEELAGR
RAANGSGNAASTPDYGEKKLPQALIIGVKKGGTRALLEAIRVHPDVRAVGVEPHFFDRNYEKGLEWYR*
59 >lcl|XP_001789733.1|Plus1complement(372137..374194) NW_001494052 leucine carboxyl methyltransferase 2 (predicted)-like LCMT2 __SEG__ Chr21 {Bos taurus} MGSRNRERRAEAVQSTNDSSALSKSSLAARGYVHDAFAALLVPGTARRAPLIHRGYYVRARAVRHCVRAFIEQTCAAPGTPRAQILSLGAGSDSLYFRLKTAGHLAGAAV
WEVDFPDVAERKAQRIRDTPDLCALTGPFQSGDHGSTLCFESSDYRILGLDLRQLQRLDQALAAAGLDAAFPTLLLAEAVLTYLEPDDAAALIAWAAQRFSNAIFVVYEQ
MRPQDAFGEFMQQHFRHLNSPLHGLDRFPDAEAQQQRFLQAGWTACRAMDLNEFYRCFLPAEERRRMENLEPFDEFEEWHLKCAHYFILAASRGDSLSQTLVFPPSETFP
RIDPASPSGVFPASVVTGDTQGLGLKRYGHASVLLSPGVILSAGGFGEQEGRHCRVSKFHMLLRYSDFEWKGNQIGSWGTGAQWDGRLYHTMTRLSDTQVLVLGGRLSPV
TPALGILQLCCENEDNSTEDPIVTVTKFGPEEDSTLSRWRHSTTEVSCENQKYLFVYGGRSVAEPVLSDWHFLHVGTMTWVRIPVEGEGPEGRHSHSACSWQGGALIAGG
LGVSEEPLSSVFFMKPITSGFLWESIAIQPPITPRYSHTAHVINGKLLLVGGVWIHSSAVPGVTVIALSTGLSFEYQIDTTCVPWPLMLHNHTSILFPEEQQLLLLGGGG
NCFSFGTYFNPHTVTLDLSPLRARQ*
60 >lcl|XP_001789826.1|Plus1complement(315635..316126) NW_001494172 heat shock 70kDa protein 8 LOC781081 __SEG__ Chr23 {Bos taurus} MAKNMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVINDGDKPKVQVSYKGE
TKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVHRRTSTTRSGRPPRTRG*
61 >lcl|XP_001790138.1|Plus12041512..2042522 NW_001494832 similar to magnesium transporter 1 LOC100138302 __SEG__ Chr3 {Bos taurus} MEECWWLRHVSLTVVALMFMTPEASAHPDQGQKVLEEKVRQLMDWTKRDRVMRMNTAAFNHFVLEKPRNYSVIAMFTALQRFRSCAPCKLAVEEFQVLAGSWQFSSAFSN
KVFFAMLDFDESPEVFKTLQVKGGPVVLHLPAKSEFTADDIYNFQVRDISAQHMFTWVDDRTGRWMGNFTTRQPIHFHYPFKLGISVALIGGLVYVLKWKRTFIFSKNFW
AVLALCFVILMSSGRMWIHIRGAPFAESKTHTGQTHYIQDTYFFQYVAEMYIISLFYMCITLGMVLLSTAATSRMNIIRRKIMSVTGMCLLVIFFSWLLSLVRLKYHVYP
FRILMN*
62 >lcl|XP_001790613.1|Plus1953102..953950 NW_001494312 tyrosylprotein sulfotransferase 1-like isoform 1 LOC782311 __SEG__ Chr25 {Bos taurus} MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPLKLENIKTTVRTALDIKANKTFAYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILAL
KQIWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLARLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIE
TMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTVLKFLQIPWNHSVLHHEEMIGKAGGVSLSK*
63 >lcl|XP_002684384.1|Plus13616766..3617080 NW_001493312 small ubiquitin-related modifier 3-like LOC100335868 __SEG__ Chr15 {Bos taurus} MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMENEDTIDMFQQQMGGSRVASCLLGSGL*
64 >lcl|XP_002684561.1|Plus17012355..7012753 NW_001494158 TRIM5/CypA fusion protein-like LOC100296156 __SEG__ Chr23 {Bos taurus} MVNPTLFIEPWEEKIWNKGPCFHRIIPGLMCQGGDFACRNGTSGKSIYGEKFDENFTLKHVGAGILSMAKAGPNTNGSLFFICTAKTEWLDGKLIVFDRVKGGMNIVEAM
EHFGFRNGKTSKKITIGDRGQI*
65 >lcl|XP_002701363.1|Plus1929987..930286 NW_001493301 autophagy-related protein 12-like LOC100295710 __SEG__ Chr15 {Bos taurus} MAEESALQFPPSTAPEAEGPKEVSPETATPEPTSSATVSLGTEEPVADTKKKSNILLKAVGDTTIMKTKKWAVERTQTIQGLIDFIKKFLKLVASEQLV*
66 >lcl|XP_002701683.1|Plus1complement(5148316..5149356) NW_001493476 ring finger protein 146-like LOC100336258 __SEG__ Chr17 {Bos taurus} MMAGCGETDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDRPTLLSPELKAASRGNGEYAWYYEGR
NGWWQYDERTSRELEDAFSKGKKSTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDANTVNLARESSADGADSVPAQSGASVQSSSVRPLT
SVDGQLTSPATPSPDVGTSLEDSFAHLQLGGDSIAERSHRGEGEEEHESPSSGRVPAPDTSIEETESDASSDSEDVSALVAQHSLTQQRLLVPNPSQTVSDRSVAAGGIV
SVRSRRPDGQCTVTEV*
67 >lcl|XP_002701772.1|Plus1complement(2561877..2564330) NW_001493536 a disintegrin and metalloproteinase domain 1 ADAM1 __SEG__ Chr17 {Bos taurus} MSVAASVRDSASVLPSLWKRQLALSEAIRVLQTWAPHMKGLRLALVPGLSCARLGILLFLVLISLPSLYCDLGSPYHSSYEVVIPKSLTVEGREDQVEKLSYVLFMQGQR
QLIHLTLKTDYFVDNFPVFSYHDGILGQEMPLISRDCHYEGYIEGVPGSFVSVNTCSGLRGLLIKEGKSYGLEPVHSSKRFEHLLYAMAHEARVSCGVTSKDSQVASTSR
RPESGKPHSWQVPSDLWSHTKYVEMFVVVNNQRFQMWGSDVNQTVQRVMDIIALANSFTRGINTEVVLAGMEIWTEGDLTEVPVDLQVALRNFNSWRQEKLFHRVKHDVA
HMIVGQHPREDTGQAFLSGACSSDFAAAVESFHHEDVLLFAALMVHELGHNLGIRHDHPACMCKDRPFCLMRENITKESGFSNCSSDFFHRFLWEHKGACLFNKPGHKGR
RRRDSTCGNAIVEGDEQCDCGNACEVDKCCDDTCRLKSTALCNPGPCCNATCQYERTGRSCRPASGECDLPEFCLGTSGECPQDTYKLDGSECMGGYYCVDGVCMSSDAQ
CSEIFGFPAKAASEQCFQSFNGKGNRFGNCGIPSDSVSEYTKCQNEDVFCGKMICTNVQELPETQVNYTLLQAHYKDDYCWSMDKYSVQDVPDSGDTKKGNLCAPGKVCI
DFVCLDVSVLGYDCDTKVQCNAKGVCNNKKNCHCDDGFSPPDCKNPGPGGSVDSGYPGLDNPEPGEGGEENATSETHEASKNILDIIIPLAAILCIALLLLIIFCVCTFC
KEDQGAAAESKEEPAAPEEEPPEEEAEEEEVEEEEEEEEEEEEESEP*
68 >lcl|XP_002701986.1|Plus1complement(1665000..1665338) NW_001493627 glutaredoxin (thioltransferase)-like LOC100297193 __SEG__ Chr18 {Bos taurus} MSQAFMNSRVQSGKVVVFIKPTCPYCRRTQKLLSELPFKQGLLEFVDIQILYLIGANGDTDEIQDYLQQLTGARTVPRVFIGKDCIGGCTDLVNIHERGELLTRIKQIGA
LQ*
69 >lcl|XP_002702517.1|Plus1complement(83623..84360) NW_001493914 tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide LOC100336229 __SEG__ Chr20 {Bos taurus} MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEDRNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS
QAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQL
LRDNLTLWTSDTQGDEAEAGEGGEN*
70 >lcl|XP_002703037.1|Plus1129082..129255 NW_001494222 anaphase promoting complex subunit 11-like LOC100336142 __SEG__ Chr24 {Bos taurus} MAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNAQQVQQHCPMCRQEWKFKE*
71 >lcl|XP_002703161.1|Plus1complement(225550..226185) NW_001494310 heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1-like LOC100296463 __SEG__ Chr25 {Bos taurus} NVMPKTLDGQLTMEKTPSYFVTNEAPKRIHSMAKDIKLIVVVRNPVTRAISDYTQTLSKKPEIPTFEVLAFKNRTLGLIDASWSAIRIGIYALHLENWLQYFPLSQILFV
SGERLIVDPAGEMAKVQDFLGLKRVVTEKHFYFNKTKGFPCLKKPEDSSAPRCLGKSKGRTHPRIDPDVIHRLRKFYKPFNMMFYQMTGQDFQWEQEEGDK*
72 >lcl|XP_002703679.1|Plus14244274..4244588 NW_001494606 zinc finger protein 313-like LOC100297757 __SEG__ Chr2 {Bos taurus} MAAPLQGRGQSEANLLGHFECLVCLEMSEKPVQLPCERIFCPEFLQECLKPKKPLCALCCNALAPESQRGDGRTATQPMESTKTSCHGFCKHFKKPLGNLTCVP*
73 >lcl|XP_002703720.1|Plus1complement(2738822..2739043) NW_001494647 ubiquitin-like 5 LOC100295962 __SEG__ Chr2 {Bos taurus} MTEAFCKDPLGKKVCIKCNTDDTIGNLKKLMIAQTGTGQNNIVLKKWYMILKHHVSLGNNEIHNGMNLKLYYQ*
74 >lcl|XP_002704513.1|Plus1184496..184846 NW_001495105 DnaJ homolog, subfamily C, member 19 LOC100297751 __SEG__ Chr5 {Bos taurus} MASIVVAVGLTIAAAGFAGRYALQAMKHMEPQVKQVFQSLPKTAFSGGYYRGGFEPKMTKWEAALILGVSPTANKAKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLL
EGQATK*
75 >lcl|XP_002704662.1|Plus1500794..501576 NW_001495211 NVL protein-like LOC100336375 __SEG__ Chr6 {Bos taurus} MSGLLKVLDQGYVLVRNPDQFRALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSARETG
ASVRVVNQLLTEMDGLETRQQVFIMAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPTLDADVNLEAIAGDLRCDCYTGADLSALVREASICALK
QEMARQKSGSEKGELKIGQKHFEEAFKKVKSSISKEASNV*
76 >lcl|XP_002705069.1|Plus1953196..953633 NW_001495473 ubiquitin-conjugating enzyme E2v2 LOC100336122 __SEG__ Chr8 {Bos taurus} MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQ
NSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN*
77 >lcl|XP_002705238.1|Plus1complement(459383..459628) NW_001495583 neural precursor cell expressed, developmentally down-regulated 8 LOC100296298 __SEG__ Chr9 {Bos taurus} MLIKVKTLTRKEIEIDTEPTDKVEQIKERVKEKEGIPPEQQRLTYSGRQINVKKTSTDYRLLSGSVLHLVLALRGGGGLRQ*
78 >lcl|XP_002707224.1|Plus1850643..850864 NW_001508718 hypothetical protein MGC134179 MGC134179 __SEG__ ChrX {Bos taurus} MMALNCICKELLNLCHRYPHSPCSGGPVDNDMFHWQVKIMGPKDSPYQGGVFFLRIQFPSKYPFKPLKIMFSA*
79 >lcl|XP_582688.2|Plus11683989..1684720 NW_001494527 tyrosine 3/tryptophan 5 -monooxygenase activation protein, theta polypeptide isoform 1 LOC506261 __SEG__ Chr29 {Bos taurus} MEKTELIQKVKLAEQAEHYDDMATCMKAMTEQGAEPSNEERNLLSVAYKVVGGRRSAWRVISSFEQKTDTSDKKLQLIKDYWEKVESKLRSICTTVLELLDKYLTANATN
PESVFYLKMKGDYFRYLAEVACDDDQKQTIDNSQGAYQEAFHISKKEMQPTHPIGLGLALNFSVLYYEILNNPELACTLAKTAFDEALAELDTLNEDSCKDSTLIMQLLR
DNLALWTSDSAGEERDVAEGAEN*
80 >lcl|XP_582943.2|Plus16114181..6115365 NW_001494181 NHL repeat containing 1 NHLRC1 __SEG__ Chr23 {Bos taurus} MGAEAAGSGPALRELLREAETSLLECKVCFERFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPFCRRACRGCDTSDCLPVLHFLELLGSALRPGPAAPRAAPSA
PGVLTCQHAFGGWGTLVNPTGLALCPKTGRVVVVHDGKRRVKVFDSGGGCAHQFGEKGDAAQDLRYPVDVTVTNDCHVVVTDAGDRSLKVFDFFGQIKLVLGGHFCLPWG
VETTPQNGVLVTDAEAGSLHLLEVDFPEGVLRRTERLQAHLRHPRGVAVSWLTGAIAVLEHPLGPGACSSTTVKVFSASMQLIGQVDSFGLSLFFPSKITASAVAFDHQG
NVVVADTSSPAVLCLGKPEEFPVLKPIITHGLSHPVALTFTKESSLLVLDSAAHSVKVYKVDWG*
81 >lcl|XP_584098.3|Plus1complement(18743..20776) NW_001848880 fidgetin-like FIGNL1 __SEG__ Chr4 {Bos taurus} MQASSSRSVHLSDWQKNYFALTSGTCTPGQKADAYRAQILRIQYAWANSDISQVCATTLFRKYAEKYSAVIDSDNVETGLNNYAESILTLARSQQTDSDKWKSGLSVNNV
FKLSSVQEMMRAGKKSKDSLLAPADASLVIHKEATVFDLPTFSVCGGSGESNLLTNSAHSADRTQEFPEGGPSLTCPQSAQPPLVNNTTKTCPVASAPFGESGLAKFHAK
PLFGNVKKENNSFVKGNIGLNVFSSNQSCFPSFCDNARDKKAFYGAGTIDALSTPILNKAFSKTEDNGQRGESSLPAFKTAKEQLWVDQQKKHHQPQRASGSSYGGVKKS
LGAGRSRGIFGKFVPPVPKQDGGDPGGGMQYKPQGAGTADPAHPMDERLKNLEPRMIELIMNEIMDQGPPVNWEDIAGVEFAKTTIKEIVVWPMLRPDIFTGLRGPPKGI
LLFGPPGTGKTLIGKCIASQAGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGAATSSEDRILVVGATNR
PQEIDEAARRRLVKRLYIPLPEASARKQIVVNLMSKEQCCLSEEELELVVQHSDGFSGADMTQLCREASLGPIRSLQAVDIATITPDQVRPIAYSDFENAFRTVRPSVSP
EDLELYENWNRTFGCGK*
82 >lcl|XP_585522.1|Plus1complement(195293..195808) NW_001494798 tetratricopeptide repeat protein 9C-like LOC508705 __SEG__ Chr3 {Bos taurus} MEKRLQEAQLYKEKGNQCYREGKYRDAVSGYHRALLQLRGLDPSLPSPIPNLGPQGLALTPEQENLLHTTQTDCYNNLAACLLQMEPVNYERVKEYSQKDVERQPDNAKA
LYRAGVAFFHLQDYDQARHYLMAAVNRKPKDANVRRYLQRTQLELSSYHRKEKQLYLGMFG*
83 >lcl|XP_587992.2|Plus11253314..1253814 NW_001494757 FKBP1A protein-like FKBP1A __SEG__ Chr3 {Bos taurus} MKPIKQKVLSNHHTSTINRANKNLRSTAEPWNPARSGLGPRCRSRSPSANPASAATAAMGVQVKTISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLG
KQEVIRGWEEWVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVEFLKLE*
84 >lcl|XP_588351.2|Plus115867..17168 NW_001493298 ring finger protein 26-like RNF26 __SEG__ Chr15 {Bos taurus} MEAVYLVVNGVGLLLDVLTLVLDLNFLLVSSLLASLAWLLAFIYNLPHTVLTSLLHLGRGVLLSLLALIEAMVRFTCGGLQALSTVLYSCSSGLESLKLLGHLASHGALR
SREILHRGVLNMVSNGHALLRQICDVCAITMSLVAYVINSLVNICLIGTQNFFSLVLALWDAVMGPLWRMTDVVAAFLAHISSSAVAMSILLWTPCQLVLELLASAARLL
GSFVLVNLTGLVLLACVLAVTVTLLHPDLTLRLATRALSQLHARPSYHRLREDVVRLSRLVLGLEAWRRVWSRSLQLASWPNRGGAPGAPQGGPRRLTSARTWRQDALPE
AGPRSEAEEEEVRMARVTAARGRERLNEEESVAGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRQGILQTLNVYL*
85 >lcl|XP_588564.2|Plus1complement(91955..92446) NW_001494720 S-phase kinase-associated protein 1 SKP1 __SEG__ Chr3 {Bos taurus} MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYL
DIKGLLDVTCKTVANMIKGKTPEEIQKTFNIKNDFTEEEEAQVRKENQWCEEK*
86 >lcl|XP_589324.4|Plus164577..65899 NW_001492984 PDIA6 protein-like PDIA6 __SEG__ Chr10 {Bos taurus} MARLVLGLMSCTLFITVNRLYSSSDDVIELTPSNFNREVIQSYSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHQSLGGQHGVQGFPTIKIFGSNKNK
PEDYQGGGTGEAIVDAALSALCQLVKERLGGRGRGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAV
DASVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRRRSDIVSRALDLFSDNAPPPELLEIINEDVAKKTCEEHQLCVVAVVPHILDTGAAGRNSYLEVLLKLADKYKKK
MWGWLWTEAGAQSEPENTLGIGEFGYPAMAAINAREMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDDLEKGEL
*
87 >lcl|XP_589404.2|Plus1complement(1599015..1599545) NW_001495428 low density lipoprotein receptor-related protein associated protein 1-like LOC511975 __SEG__ Chr8 {Bos taurus} MKEESVEKGRVGKALEESHENAIRPVDLSGVQTEALASRHAELKDRLRSIGQGFDWLRRVSHQGYGAETEFTEPRVLDPWDMAKSANFTEKELESFREELKHFEVKIEKH
NHYQKQLEISHRKLKHVESFGDQEHVTRNKERYAMLEEKTKELGYKVKKHMQDLSSRISRARHNEL*
88 >lcl|XP_589747.1|Plus1complement(553785..555716) NW_001494721 heat shock protein 70-like HSPA6 __SEG__ Chr3 {Bos taurus} MSAARELAIGIDLGTTYSCVGVFQHGRVEILANDQGNRTTPSYVAFSDTERLVGDAAKSQAALNPHNTVFDVKRLIGRRFTDPSVQSDMKHWPFQVVSEGGKPKVRVSYR
GEDKAFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRLGAGERNVLIFDLGGGTFDVSVLTIDAGVFE
VKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSRNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLGK
AQIHDIVLVGGSTRIPKVQKLLQDFFDGRELNKSINPDEAVAYGAAVQAAVLMGDTCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQPGV
LIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVREAEQYKAEDEAQRDRVAAKNSLEAYVFH
VKSSLQEERLRDKIPEEDRRKVQDKCQEVLAWLEHNQLADKEEYEHQKRELEQICCPIFSRLYGGPGVSVGSSCGAQARHGAPSTGPVIEEVD*
89 >lcl|XP_589866.2|Plus1complement(733695..736028) NW_001495225 ankyrin repeat domain 56-like LOC512359 __SEG__ Chr6 {Bos taurus} MARELSQEALLDFLCQAGGRVTNAALLSHFKSFLRDPDAPPSQQQRRRELFKGYVNSVAAVRQDPDGTKYVVLKRRYRDLVGEEEGLRRPRDPPAGAAPAGGAAPGSPLP
ARRGEHPPQPQPGRRIRREEAPAGAAAPVADAGCNGLPAGGAREAARGGGRPRGRSGHRAPVPAAAVAAAAQDRARCAAAETQGRCCWECLQNGLGGLPDPATASASAAE
KLAQDDRGAPRPQWEGVLAEPPPGPATPRSPPATVEAAAPPAVLSSPSPAGDPPAPVTPGSVHYSTLQQQQQRTREWVARHPQVPETRDHGPVRAWSVLPDDFPRLPSEQ
GSWVQESESAPAEPPPPSQSLVFPTVSEVWPGDSQLAVFRSIRCQLSLQDLEDFVEQESHGSEESSSGPKESPGGSEDGLRLALGAPDGRRLRNPAGAPPKEARPTRSPQ
GLRNVGDAHTSQPVSTGADGPAGDPQPLSWPAPKLRRSLRRNSRAGRAKLSSSDEECLQEDLLKRSRRPPRSRKPSRVGAMSSPRVDAALTLAHADIKAAAAAERNHPHS
WQVPGGDRLAALVPHRSSEHKSSLVPLDAREHEWIVKLASGSWIRVLSLFWEDPQLALHKDFLTGYTALHWIAKHGALRALQDLASSAQKAGVALDVNVKSSCGYTPLHL
AAIHGHQGIIKLLVQRLASRVNIRDSSGKKPWQYLTSNTSGEIWQLLEAPRGKPIFPTYSLVRSSSPTRKVKSQEVSRHVTRKTSLAALLKSQHTKWKLANQYEKCPNLR
EREEDSA*
90 >lcl|XP_590020.1|Plus11697303..1699684 NW_001494376 DnaJ (Hsp40) homolog, subfamily C, member 10-like isoform 2 DNAJC10 __SEG__ Chr26 {Bos taurus} MGVWLNKDDYVRDLKRVMLFFLVMYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHSDFLKVNRAYEVLKDEDLRKKYDKYGEKGLADNQGG
QYESWNYYRYDFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKVVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDR
SKESLMNFAMQHVRSTVTELWTGNFVNSIQTAFAAGIGWLITFCSEGSDCLTSQTRLRLSGMLDGLVNVGWVDCATQDNLCKSLDITTSTTAYFPPGATLNNKEKSGILF
LNSLDAKEIYLEIMHNLPDFELLSANSLQDRLAHHRWLLFFQFGQNENSNDPELKKLKTLLKNEHIQIGKFDCSSAPDVCSNFYVFQPCLAVFKGQGTKEFEIHHGKKIL
YDILALAKESVNSHVTTLGPQNFPANEKEPWLVDFFAPWCPPCRALLPELRKASKHLYGQLKFGTLDCTIHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFV
EDLMNPSVISLTPTTFNELVKQRKHDEVWMVDFYSPWCHPCQILMPEWKRMARTLIGLINVGSIDCQQYHSFCAQENVRRYPEIRFFPQKSNKAYEYHSYNGWNRDAYSL
RIWGLGFLPQASIDLTPQTFNEKVLQGKNHWVVDFYAPWCGPCQNFAPEFELLARTLKGKVKAGKVDCQAYAQTCQKAGIRAYPTVRLYPYERAKRNTWGEQIDSRDAKE
IATLIYEKLEKLQNHEKRDKDEL*
91 >lcl|XP_592083.1|Plus1245745..246374 NW_001494990 COP9 signalosome subunit 8 isoform 1 COPS8 __SEG__ Chr5 {Bos taurus} MPVAVMAESSFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQQIWQRDFPGVYSTINAHQWSEAVQPIMEALR
DATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTIRIVMPKKPVAGTLDVSFNRFISLSEPTPVPPIPKEQQLARLTDYVAFLKN*
92 >lcl|XP_594949.2|Plus1263952..265013 NW_001502352 ring finger protein 167 LOC516790 __SEG__ Chr20 {Bos taurus} MPPTALCLPVVVATLLWGASPVRGLIRATSDHNGSMEFADLPALFGAALSPEGLKGFLVEAQPANACSPIAPPPPAQANGSVFIALLRRFDCKFDLKVLHAQKAGYGAAV
VHNVNSNELLNMVGSNEEVQQQIWIPSVFISEKSSQYLRAFFIYQQGAQVLLVPDNGFLSTYFFILFYGILAMLILGTGAIVIVHWIHFQKQRWRNLLTKEQLKQIPTHD
YRRGDRYDVCAICLDEYEDGDKLRVLPCAHAYHCRCVDPWLTQTKKTCPICKQPVCRNLGEEEQEEGTQVQMGHEEGGLRSRPASERTSLLGSSTVLPTNFGSLAPAPFV
FLGSSTDPSHSPSSSSSSAVNLI*
93 >lcl|XP_596209.3|Plus1complement(461884..462939) NW_001494522 ring finger protein 113A LOC518027 __SEG__ Chr29 {Bos taurus} MAEQLSPGKTTDQVCTFLFRKPGRKGGAGRRKRLICDQESGGGGGGGGGSSSSSSGDEGNRVVRPEKKRAIHTPMIQKTWGGGKQKGASGNRSSEEEVEEPESLGVVYKS
TRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSRKIREELRGKEDDKIYRGMNNYQKYMRPKDASAGSDSSGMARKGPIRAPEHLRATVRWDYQPDICKDYKETGFCG
FGDSCKFLHDRSDYKHGWQIQRELDEGRYGVDEDENYEVARDEEELPFKCFICRQTFQNPVVTKCRHYFCEGCALQHFRTTSRCYVCDQQTNGVFNPAKELIAKLEKRRA
AEEGGASNFPEDPDKGPIPIT*
94 >lcl|XP_596809.3|Plus12623228..2625198 NW_001495013 fidgetin-like 2-like FIGNL2 __SEG__ Chr5 {Bos taurus} MHWTPEHAQPLNQWPEQHLDVSSTTPSPAHKLELPPGGRQRCHYAWAHDDISALTASNLLKRYAEKYSGVLDSPYERPTLGGYGDAAFLNGAKGDPEPWPGPETPYPLAS
LHEGLPGTKSGGGGGSGGLGGSPVLAGNLPEPLYAGNACGGPSAAPEYAAGYGAGYLAPGYCAQTGAALPPPPPAALLQPPPPPGYGPSGSLYNYPAGGYAAQPGYGALP
PPPAPPPAPYLTSGLAAPTPLPTPAPPRPSPASYGFQGVTEAGVSLKRKATDEGAEGRYRKYAFEPAKAPAADGTSYPAADNGECRGNGFRVKPPGAAEEASGKYAGGVP
LKVLGSPVYGPQLEPFEKFSERAPAPAPRGGFAVPSGEPPKGVDQGALELATSKMVDCGPPVQWADVAGQGALKAALEEELVWPLLRPPTYPGSPRPPRTVLLFGPRGAG
KALLGRCLATQLGATLLRLRGGTLVAPGAAEGARLLQAAFAAARCRPPAVLLISELDALLSVRDDGTAAAGALQAPLLACLDGGCGAGADGVLVVGTTSRPAALDEATRR
RFALRFYVTLPDGPARGQILQRALAQQGCALSERELAALVQGTQGFSGGELGQLCQQAAAGAGLPGLQRPISYKDMEAALAKVGPRASPKDLDSFVEWDKMYGFGH*
95 >lcl|XP_596872.2|Plus11742111..1742806 NW_001494130 DnaJ homolog, subfamily B, member 8-like DNAJB8 __SEG__ Chr22 {Bos taurus} MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSLYDRAGCDGWRLGGTGSPHGSPFGGGYTFRNPEDIFREFFGGLDPFS
FDFWDAPFGSERGARGHGLRGAFSAGFGEFPAFMEAFSAFDSLGRGGAGRTTFSSTSFGGSGSGGSGFKSVMSSTEIVNGHKVTTKRIVENGQERVEVEEDGQLTSVTIN
GKEQLKRVDSK*
96 >lcl|XP_598451.2|Plus1complement(201920..202678) NW_001494721 proteasome activator subunit 3-like LOC520216 __SEG__ Chr3 {Bos taurus} MASPLKLEQDVLGKVDSFRARIAQEAEDLVSTFFPQKLSELDSRVQELRLQDLSRIRSVPAPESLIAPESLITPDTAGDGPKRDPPPLQTQSSIKVLALPGGEGQLLRSN
QHLVELIERVKPEIELLREKCNTVRMWVQLLIPKVEDGNNFGVSIQEDTVDQLWTVESTAASYLRRFSTYYNTRAKLVSKIVKYPQVEDYRRTVAEVDENEYLSVRQILL
HLRNQYATLHDVILKNIEKIKTPRSTNTDNLY*
97 >lcl|XP_602690.2|Plus1complement(840078..840713) NW_001493666 ring finger protein 222-like RNF222 __SEG__ Chr19 {Bos taurus} MSEGESKDSSGSECPVCYEKFRELQGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTIVCPICRYVTFLSRKSSRWPAKLDKSSQILAVPVGLPPSPLPDALGHANPLA
LSQPVWRSSPGQGGQLPLDPPPSLPREPQIFIISRHGMPLGEQDSVLPRRSLAELSGASLAPSSTRSFCCRSRALLLITLIAVVAVVAAILPWVLLVRKQA*
98 >lcl|XP_608638.2|Plus11354338..1355783 NW_001493113 hCG2019360-like OTUD1 __SEG__ Chr13 {Bos taurus} MQLYSSVCTHYPAGGQGPTAATAAPPAAATATSFKVSLQPPGPAGGAPEPETGECQPAAAAEPREAAAAPAAKMPAFSSCFEMVSGAAAPASAAAAGPPGGSCKPPLPPH
YTSTAQITVRALGADRLLLRGPEPGAAAPAAPRGRCLLLAPAAGAPIPPRRGSSAWLLEELLRPDGPEPAGLDATREGPDRNFRLSEHRQALAAAKHRGPAPPPGSPEPG
PGPWAEERPAERNLRGWDRAGDRRDAPGAEEPGRPDPEAEAAPARSGEAAPGGATEAVIVSRSDPRDEKLALYLAEVERQDKYLRQRNKYRFHIIPDGNCLYRAVSKAVY
GDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFDHSY
PNPEYDTWCRQTQVQRKRDEELAKSMAISLSKMYIEQNACS*
99 >lcl|XP_610019.2|Plus133825..35975 NW_001494740 ADAM metallopeptidase domain 30 LOC531521 __SEG__ Chr3 {Bos taurus} MRSVRTCLSPGRSLVLAVLLVDSLGKDLHFHPEWGFDSYEITIPKKLSFRGGEQRAARHVSYLLKVKGRNRVVHLWPKRFLLPRNLQVFSFTEQGRLLEEHPYIPSDCNY
MGLVEGNPDSQATISTCMGGLRGILKIDANHYQIEPRKASSQFEHVVYLMKKEEEFPNQICGITDDKTIEQMAQHENMARTPDFTDLYPHQMYMEIALVFDNSRYLFSNS
NLTQVINDAILLTSIMDSYFQDIRLRIHLFSVEVWTDKDRIRVNFTKIEQVLSQFLVYRTSVLNTRVPVDWVHLYLKRTFSDLLAQSGGHACSRFYAGSVSVFPDVNILA
PATWSTHVLGHSVGMLHDEAYCQCKGRYSCIMGTGRYGFSNCSYADYFAHIYRASSARCLTNLPGLGYVVKRCGNKIVEENEECDCGSTEECEEDGCCQPDCKFKEGANC
STGLCCHKCQFRPSGYMCRVEENECDLAEYCNGTSAFCPSDTYKQDGTPCKYEAHCFKQSCQSRYMQCQKIFGLDAKDAPHQCYDAVNVIGDQYGNCGISGLREFRKCTK
QNSICGRLQCINVETLPDMPDHTILISTHLHKENLMCWGIGYHLAMVPMGLPDLGVINDGTSCGKERVCFNRYCVNSSVLKFDCFPEKCNRRGVCNNNKNCHCMYGWAPP
LCEEVGYGGSIDSGPPGPLRKEVSASLQVVILIFMRLFFLIISVIVVFYRKIIESL*
100 >lcl|XP_611641.2|Plus13068220..3070466 NW_001494589 fidgetin-like FIGN __SEG__ Chr2 {Bos taurus} MQWTPEHAQWPEQHFDITSTTRSPAHKVEAYRGHLQRTYQYAWANDDISALTASNLLKKYAEKYSGILEGPVDRPVLSNYSDAPSGLVNGRKNESEPWQPSLNSDAVYPM
NCVPDVITASKAGVSSALPPADVSASIGSSPGVASNLTEPSYSSSTCGSHTVPSLHTGLPSQEYAPGYNGSYLHSTYSSQPAPALPSPHPSPLHSSGLLQPPPPPPPPPA
LVPGYNGTSNLSSYSYPSASYPPQTAVGSGYSPGGAPPPPSAYLPSGIPAPTPLPPTTVPGYTYQGHGLTPIAPSALTNSSASSLKRKAFYMAGQGDMDSSYGNYSYGQQ
RSTQSPMYRMSDSSISNSNRGNGFDRSAETSSLAFKPTKQLMSSEQQRKFSSQSSRALTPPSYSTAKNSLGSRSSESFGKYTSPVMSEHGEEHRQLLSHPMQGPGLRAAT
SANHSVDEQLKNTDTHLIDLVTNEIITQGPPVDWNDIAGLDLVKAVIKEEVLWPVLRSDAFSGLTALPRSILLFGPRGTGKTLLGRCIASQLGATFFKIAGSGLIAKWLG
EAEKIIHASFLVARCRQPSVIFVSDIDMLLSSQVSEEHSPVSRMRTEFLMQLDTVLTSAEDQIIVICATSKPEEIDESLRRYFMKRLLIPLPDSTARHQIIVQLLSQHNY
CLNDKEFALLVQRTEGFSGLDVAHLCQEAVVGPLHAMPATDLSAIMPSQLRPVTYQDFENAFCKIQPSISQKELDMYVEWNKMFGCSQ*
101 >lcl|XP_868977.1|Plus120638..21132 NW_001494877 TRIM5/CypA fusion protein-like isoform 1 PPIA __SEG__ Chr4 {Bos taurus} MVNPTVFFNIAVDGEPLGRVSFELFADKVPKTAENVHALRTGEKGFGYKGSCFHRIIPGFMCQGGDSTCHNGTGGKSIYGEKFDDENFILKHTGPGILSTANAGPNTNGS
QFFTCTAKTEWLDGKHVVFGKVKEGMDVVEAMERFGSRNGKTSKKITIADCGQI*
102 >lcl|XP_870112.2|Plus1complement(1490694..1493018) NW_001492869 enhanced at puberty 1-like LOC613845 __SEG__ Chr10 {Bos taurus} MSAAQVSSSRRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRAHGCFQDGRSPGPPPPVGVKTVALSAKEAAAAAAAAAAAAQQQQQQQQQQQ
QLNHVDGSSKAAVLAAPSGLERYGLSAAAAAAVEQRSRFEYPPPPVSLGSSSHAARLPNGLGGPNGFPKPNPEEGPPELNRQSPNSSSAAASVASRRGTHGGLVAGLPNP
GGGGGPQLTVPPNLLPQTLLNGPASAPVLPPPPPHALGSRGPPTPAPPGAPGGPACLGGAPGVSVASSSAASSTSSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAE
ALAELSESLRNRAEEWANKPKMVRDTLLTLAGCTPYEVRFKKDHSLLGRVFAFDAVSKPGMDYELKLFIEYPTGSGNVYSSASGVAKQMYQDCMKDFGRGLSSGFKYLEY
EKKHGSGDWRLLGDLLPEAVRFFKEGVPGADMLPQPYLDASCPMLPTALVSLSRAPSAPPGTGALPPATPSGRGAAASLRKRKASPEPPDSAEGALKLGEEQQRQQWMAN
QSEALKLTMSAGGFAAPGHAAGGPPPPPPPLGPHSNRTTPPESAPQNGPSPMAALMSVADTLGTAHSPKDGSSVHSTTASARRNSSSPVSPASVPGQRRLTSRNGDLNLQ
VAPPPPSTHPGMDQVHPQNIPDSPMANSGPLCCTICHERLEDTHFVQCPSVPSHKFCFPCSRESIKAQGATGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKK
ERDP*
103 >lcl|XP_872097.2|Plus1complement(608881..611106) NW_001492865 a disintegrin and metallopeptidase domain 6-like LOC615247 __SEG__ Chr10 {Bos taurus} MGRACTQAHLRGDLWLPLLWLFLFPTCYSHDPPGWRFTSSEIVIPRKVSHRVSGIERQGQLSYKIRFSGQRHVVHLRVKKNLLPRHFPVITDNDQGAMQENYPYIPRDCY
YFSYIEGVPGSMGTLDTCYGGLHGMLQLDDFTYEIKPLEASSKFEHLISQLVTQKTAAEDEKCEAEEKDTNQEYEEAIISEMPRAGPVYLWWPHRKALKVHYTVSHSLYI
QDINMTHIIENMVILNNIIHSIYYQGQLQVLIRVLCIWDGKDRMNLHRYENVNTAVTHFGLYKLYGWYEQIPHDTSLLVTGHKIAGASYASSFEGVCNPNWGVSYVFAPR
YHLFLTAIIGAHSIGHVLGCRHDVPGCQCFRRQHCLMNSNPGLLDMMSNCTFERIHRRLHMWDPCLSVPYVPYDNFPYIARRCGDKKIDPNEECDCGTLKDCTQDRCCNS
NCALSLGSDCDYGGCCRNCKYAYPGYICRDTLGICDLPEYCNGKTHDCPDDTYIQDGTPCSPSAVCVRGNCSDRDLQCQALFGYNIRQAASSCYEVLNIRGDRFGNCGVK
LTRGGGKPVACEQDDVLCGMLHCSDVKEIPGGGEHTTFHQIIVHDVTPQTCFGYDAHFGTDVPEMGLVVDGATCGPGAYCKDQNCTFFQDLGFDCDVKKCNYRGVCNNRK
HCHCQQGWKPPNCTERGPGGSVDSGPPPDRELGIRASLRLSLNRALALLLLRLCLLFSAAFIGATYYVKDILEEEDENVEN*
104 >lcl|XP_875489.2|Plus1959219..959440 NW_001493813 ubiquitin-like 5 LOC618066 __SEG__ Chr1 {Bos taurus} MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTHWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ*
105 >lcl|XP_875959.1|Plus1complement(1236663..1237163) NW_001494565 peptidylprolyl isomerase-like 1 LOC618533 __SEG__ Chr2 {Bos taurus} MAAIPPDSWQPPNVYLETSMGIIVLELYWKDAPKTCKNFAELAHRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELYPDLKFTGAGILAMANAGPDTNGS
RFFVTLAPTQRLDGKHTIFGRVCQGIGMVNRVGMVETNSQDCPVDDVKIIKAYPSG*
106 >lcl|XP_875999.1|Plus1887460..889064 NW_001494967 T-complex protein 1-like LOC618575 __SEG__ Chr4 {Bos taurus} MDRRAPPTAPELPERLPAEEKHLLSSLAAADTLARVLRPCYGPQGRQKLLVTAKGDTVLTGHAAAILRALQLEHPAARLLREAAQGQAEQSGDGAAFVVLLAQALLAQAE
RLLRAGLPRAQLREAYAAVAAETLALLPSLAVRALGPLEDPVWALRSVMNTHALWRTDHLAGLVARACWATRELDGGFRPERVGVCALPGARQEDSCLLPGLALPGKPCG
QVTMVLSGARVALLACDFGPARPLAPATARLSSPDDLIRFRKGSESLIEKQVAQLAAAANVVVVSGDIDEKTLTHADKYGLMVIQVASRREMVYLSEVLRTPLTPYLVPP
LEPGKCQRVYGQELGEALAVVFEWESTGTPALTLVLRGATAHGLRGAEQAAYSGIDAYFQLCQDPRLLPGAGATEMALAKMLSETGTKLEGPNGPTFLAFAQALQSLPET
LAENAGLAVPHVMAEMNGAHQAGNFLIGVGVEGIINVAQEEVWDTLIAKAQGLRAVADVVQQLLTVDDIVLAKKSPACPQDPNPEPKKRSARPL*
107 >lcl|XP_876050.2|Plus11894241..1895479 NW_001495457 CG5482-like LOC618624 __SEG__ Chr8 {Bos taurus} MASCAEPSAADPESTAPPPAGVPPLEDFEVLDGVEDAEGEEEEEEEDLSELPPLEDVGQPPLEEAEQPGALAREFLAAMEPEPEPAPAPDEWLDILGNGLLRKKTLVPGP
PGSSRPTKGQVVTVRLQTSLENGTRVQEEPELVFTLGDCDVIQALDFSVPFMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVAL
ANRKWECGNAHYQRADIVLAANSYDLAIKAITSSAKVDMTFEEEEQLLQLKVKCLNNLAVSKLKLDHYCALLRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILR
AALKLEPSNKMIHAELSKLVKKHAAQRSTETALYWKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN*