SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr N    

ID / Description / Sequence
1 >lcl|NP_001027527.1|Plus145506..46165 NW_003535119 tctex1 domain-containing protein 4 TCTEX1D4 __SEG__ Chr6 {Sus scrofa} MAGWPVPAGRQEEELAKDPGQKLSLARPPGRLPSIDETRPAGPGPASRRGSVLGPASSFSRRNSLAGAGAGPGGRRPSLGPVPPLGWRVSFSGLPLGPARRPAPSYRTEP
APGERWEAARAQRALEAALAAGLRDARYVGTEAGRLARELCDLARVHLRELSPPRYKLVCSVVLGPRAGQGVHVASRALWDTACDGLASATVTNASLFAVATVHGLYCE*
2 >lcl|XP_003133199.1|Plus1complement(471626..471757) NW_003536284 putative thymosin beta-4-like protein 6-like LOC100513953 __SEG__ Chr14 {Sus scrofa} MFDKVNMAEIEKFHKSKLMKTERQEKNPLPSKETIEQEKQAGK*