SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor N    

ID / Description / Sequence
1 >lcl|XP_002728811.1|Plus1complement(2989678..2989812) NW_047560 thymosin, beta 10-like LOC100361392 __SEG__ Chr1 {Rattus norvegicus} MADKPDMGEIASFNKAKLKKTETQEKNTLPTKETIEQENRSEIS*
2 >lcl|XP_002729447.1|Plus116227..16361 NW_047694 thymosin, beta 10-like LOC100359493 __SEG__ Chr4 {Rattus norvegicus} MADKPDMGEIASFGKAKLKKTETQEKNTLPTKETIEPEKTSEIS*
3 >lcl|XP_002729488.1|Plus1complement(39259519..39259653) NW_047696 hypothetical protein LOC100361596 __SEG__ Chr4 {Rattus norvegicus} MTDKPDMGEISSFDKAKLKKTETQEKTTLPTKETIEQEKRSEIS*
4 >lcl|XP_002730073.1|Plus1complement(3500773..3500991) NW_047815 thymosin, beta 10-like LOC100360695 __SEG__ Chr9 {Rattus norvegicus} MINWVSCCSNASGSTWSASSERESMSCKKMANKPDVGEIASFNKAKLKKTETQENTLPTKETIEQEKRSEIS*
5 >lcl|XP_233427.4|Plus18880997..8881656 NW_047718 Tctex1 domain-containing protein 4 Tctex1d4 __SEG__ Chr5 {Rattus norvegicus} MACRALSSRHQEEEATKDLALKLPPGKPGGHLPSIDETRPIGPGPASRRGSLPGLHPSFSRRNSLAGPLVGPGGRRPSLGPMPPLGSRVSFSGLPLMPARRVAPSYRIEP
APGEHWEAASAQRALKAALTTQLSDVCYSGTEAGKLVQALCEQIHIRVRELNLPRYKLVCNVVLGPREGQGVHVVSRALWDAAHDGLASATFTNPSLFAVATVHAVYWE*