SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro N    

ID / Description / Sequence
1 >lcl|XP_003310888.1|Plus1complement(3197187..3197324) NW_003457058 thymosin beta-15A-like LOC100610146 __SEG__ Chr5 {Pan troglodytes} MSYKPDMSKVGKFDREKLKKINNKEKNTLLSKETIQQEKECIQTF*
2 >lcl|XP_003339416.1|Plus1586..720 NW_003465642 thymosin beta-4-like LOC750415 __SEG__ Chr5 {Pan troglodytes} MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES*
3 >lcl|XP_513130.1|Plus1complement(132885..133556) NW_003456527 tctex1 domain-containing protein 4-like TCTEX1D4 __SEG__ Chr1 {Pan troglodytes} MASRSLPPGRQEEENAKDSGRKPSPVRPRGCLPSIDEARPAGPGPGPGPASRRGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAPARWVAPSY
RTEPVPGERWEAACAQRALEAALAAGLHDACYSSDEAARLVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGL
YCE*