SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus N    

ID / Description / Sequence
1 >lcl|NP_778195.1|Plus117251786..17252445 NT_039264 tctex1 domain-containing protein 4 Tctex1d4 __SEG__ Chr4 {Mus musculus} MACRTLPSRRQEEETTKDLALKLPPGKPGGHLPSIDETRPIGPGPASRRGSLPGLHPSFSRRNSLAGPLVGPGGRRPSLGPVPPLGSRVSFSGLPLMLPRRMAPSYRLEP
APGEHWEAAGAQRALEAALTTQLNGVCYCGSEAGKLVQALCEQIHTRVRELNLPRYKLVCNVVLGPREGQGVHVVSRALWDAVHDGLASATFTNPSLFAVATVHAVYWE*
2 >lcl|XP_001478901.1|Plus1complement(38486582..38486716) NT_039621 thymosin beta-10-like Gm3787 __SEG__ Chr15 {Mus musculus} MADKADMREIASFDKAKLKKTETQENNTLPTKETIEQVRTSEIS*
3 >lcl|XP_003084696.1|Plus1complement(74469404..74469538) NT_039353 thymosin beta-10-like LOC100504129 __SEG__ Chr6 {Mus musculus} MAGKLALGEIAGFSQAKLKKTKTHEPDNLPTKENIKQEKRTEIS*