SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul N    

ID / Description / Sequence
1 >lcl|XP_001086739.1|Plus1complement(337337..337516) NW_001105676 thymosin beta-10-like LOC697702 __SEG__ Chr18 {Macaca mulatta} MADKPDMGEIASFDKAKLKKTETQENTLPTKETIEQEKRSEIPKILEDFLPPSSSRPQS*
2 >lcl|XP_001099595.1|Plus1complement(1046974..1047639) NW_001108638 tctex1 domain-containing protein 4 TCTEX1D4 __SEG__ Chr1 {Macaca mulatta} MASRPLPPGRQEEENAKDYGPKPSPVRPRGRLPSIDEARPAGPGPGPASRRGSMLGVATSFSRRNSLAGPGAGPGGRRPSLGPVPPLGSRVSFSGLPLAPARQVAPSYRT
EPVPGERWEAARAQRALEAALSAGLRDACYSSAEAARLVQELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGIHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC
E*
3 >lcl|XP_002800169.1|Plus15704803..5704949 NW_001101663 thymosin beta-10-like LOC100427302 __SEG__ Chr15 {Macaca mulatta} MAHKLDLGEIAGLDKVKLKATEMQKNTLPTKETTEQEKRSEISYACHL*
4 >lcl|XP_002804150.1|Plus12698042..2698275 NW_001118152 thymosin beta-4-like LOC100424971 __SEG__ Chr5 {Macaca mulatta} MLKTVKQDNSVVATVQTRLRLFSRAWLRFPSATMSDKPDMAEIEKFGNSKLKKTETQEKNPLPSKETMEQEKQAGES*
5 >lcl|XP_002804546.1|Plus1complement(606809..606946) NW_001120982 hypothetical protein LOC100423728 LOC100423728 __SEG__ Chr6 {Macaca mulatta} MSDKPNMSKVGNFDREKLKKIKNKEKNTLLSKETIQQENQCIQTF*
6 >lcl|XP_002805288.1|Plus1complement(<453..1037) NW_001122540 myosin-IXa-like LOC722005 __SEG__ Chr7 {Macaca mulatta} MMLWPRMALENRLSGEDYRFLLREKNLDGSIHYGSLQSWLRVTEERRRMMERGFLPQPQQKDFDDLCSLPDLNEKTLLENLRNRFKHEKIYTYVGSILIVINPFKFLPIY
NPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRKKNQCIVISGESGSGKTQSTNFLIHHLTALSQKGFVSGVEQIILGAGPVLE