SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom N    

ID / Description / Sequence
1 >lcl|XP_003339713.1|Plus1complement(6216984..6217118) NW_001581841 thymosin beta-4-like LOC100617155 __SEG__ Chr1 {Monodelphis domestica} MSDKPDMAEIQKFDKSKLKKTETQEKNLLPSKETIEQEKQAGES*
2 >lcl|XP_003341416.1|Plus118106279..18106413 NW_001581965 thymosin beta-4-like LOC100617751 __SEG__ Chr5 {Monodelphis domestica} MSDKPDMAEIQKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES*
3 >lcl|XP_003341635.1|Plus1complement(12737406..12737540) NW_001581976 thymosin beta-4-like LOC100619033 __SEG__ Chr6 {Monodelphis domestica} MSDKPDMAEIQKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES*