SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab N    

ID / Description / Sequence
1 >lcl|XP_003364425.1|Plus113607787..13608113 NW_001867402 tctex1 domain-containing protein 4-like LOC100630644 __SEG__ Chr2 {Equus caballus} MAGRPVLSGLQEEETAKDPGPKLSPVRPPGRLPSIDEARPAGPGPASRRSSILGLVSSFSRRNSLAGPGPGPGVRRPSLGPVPPLGSRVSFSELPLAPDESAGAVLHV*