SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam N    

ID / Description / Sequence
1 >lcl|XP_003431733.1|Plus1complement(1733954..1734088) NW_876254 thymosin beta-4-like LOC100685950 __SEG__ Chr12 {Canis lupus familiaris} MSDKPDMAEIEKFGKLKLKKTETQEKNPLPSKETIEQEKQAGKS*
2 >lcl|XP_003432118.1|Plus1complement(12555763..12555897) NW_876260 thymosin beta-4-like LOC100685510 __SEG__ Chr16 {Canis lupus familiaris} MSDKPDMAEIEKFDKSELKKTEMQEKNPLPSKETIEQEKQAGES*
3 >lcl|XP_003432557.1|Plus1complement(21155368..21155502) NW_876269 thymosin beta-4-like LOC100683370 __SEG__ Chr1 {Canis lupus familiaris} MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES*
4 >lcl|XP_003432788.1|Plus1complement(6021307..6021441) NW_876271 thymosin beta-4-like LOC100688244 __SEG__ Chr20 {Canis lupus familiaris} MSDKPDMAEIEKFNKSKLKKTETQEKNPLPSKETIEQEKQAGES*
5 >lcl|XP_003433437.1|Plus1complement(16675221..16675352) NW_876282 putative thymosin beta-4-like protein 2-like LOC100684786 __SEG__ Chr26 {Canis lupus familiaris} MSNKPDMAEIEKFSKSKLKKIETQEKNLPSKETTEHRKQADKT*
6 >lcl|XP_003433653.1|Plus11435837..1435971 NW_876285 thymosin beta-4-like LOC100683107 __SEG__ Chr28 {Canis lupus familiaris} MSDKPDMAEIEKFKKSKLKKTETQEKNPLPSKETIEQEKQAGES*
7 >lcl|XP_003433774.1|Plus1complement(2252954..2253088) NW_876291 putative thymosin beta-4-like protein 2-like LOC100683231 __SEG__ Chr2 {Canis lupus familiaris} MSDKPGMSEIKKFNKSKLKETETQEKNSLLSRETTEQEKQAGKS*
8 >lcl|XP_003433832.1|Plus1complement(7481342..7481632) NW_876292 dynein light chain roadblock-type 1-like LOC608447 __SEG__ Chr2 {Canis lupus familiaris} MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKAWSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE*
9 >lcl|XP_003434769.1|Plus13401542..3401676 NW_876316 putative thymosin beta-4-like protein 2-like LOC100686562 __SEG__ Chr5 {Canis lupus familiaris} MSDKPDMPKIEKFNKSKLKKTEMQDTNPLPSKETTEQEKQASES*
10 >lcl|XP_003435249.1|Plus126653314..26653448 NW_876332 thymosin beta-4-like LOC100683220 __SEG__ Chr9 {Canis lupus familiaris} MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES*
11 >lcl|XP_539637.1|Plus115523787..15524446 NW_876259 tctex1 domain-containing protein 4-like TCTEX1D4 __SEG__ Chr15 {Canis lupus familiaris} MAGRSAPPGRQEADTPKDPGPKLPAARPAGHLPSIDEARLAGPGPSSRRGSVLGPASSFSRRNSLAGPGAGPGGRRPSLGPVPPLGSRVSFSGLPLAPLRRAAPSYRTEP
APGERWEAARVQRSLEAALAARLRSTCYSGAEAGPLTRELCELLRVRLRELCPPRYKLVCGVVLGPRAGQGVHVASRALWDAESDGLASATFTNASLFAVAMVHGLYCE*
12 >lcl|XP_543152.2|Plus111661245..11661535 NW_876278 dynein light chain roadblock-type 1-like LOC486026 __SEG__ Chr25 {Canis lupus familiaris} MAEVEETLKRLQSQKRVQVIMVVNTEGIPIKSTMDNPTTTQYANLMHNFILKAWSTVREIDPQNDLTFLQIRSKKNEIMIAPDKNYFLIVIQDPTE*