SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau N    

ID / Description / Sequence
1 >lcl|NP_001106702.1|Plus1884302..884436 NW_001493854 thymosin beta-4 TMSB4X __SEG__ Chr1 {Bos taurus} MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES*
2 >lcl|XP_001249898.1|Plus1594111..594452 NW_001493779 dynein, light chain, Tctex-type 1 LOC782237 __SEG__ Chr1 {Bos taurus} MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHGKVNKWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHRASSCFWDSSTDGSCTVRWENKTMYCIVSAFG
LSI*
3 >lcl|XP_001253473.3|Plus1161997..162131 NW_001492959 thymosin, beta 4 LOC785455 __SEG__ Chr11 {Bos taurus} MSDKPDMAEIEKFNKSKLKKTETQEKNPLPSKETIEQEKQAGES*
4 >lcl|XP_001253671.2|Plus1complement(1059274..1059408) NW_001494031 thymosin, beta 4 LOC785745 __SEG__ Chr21 {Bos taurus} MSDKPDMAEIEKFDKSKLKKTETQERNPLPSKETNEQEKQAGES*
5 >lcl|XP_001787773.1|Plus1626836..626967 NW_001508691 thymosin, beta 4 LOC100140827 __SEG__ ChrX {Bos taurus} MSDKPDMAEIKKFDKSKLKKMETQEKNPLPSKEMIEEKQVGES*
6 >lcl|XP_001790085.1|Plus1complement(3034826..3034957) NW_001493312 thymosin, beta 4 LOC100138290 __SEG__ Chr15 {Bos taurus} MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKEMIEQKQAGES*
7 >lcl|XP_002684531.1|Plus1956883..957017 NW_001494109 thymosin, beta 4 LOC100335980 __SEG__ Chr22 {Bos taurus} MSYKPDTAEIEKFGKSTLKKAEMQEKNPLPSKEMIEEERQTGES*
8 >lcl|XP_002702799.1|Plus1complement(96773..96907) NW_001494111 thymosin, beta 4 LOC100297257 __SEG__ Chr22 {Bos taurus} MSYKPDTAEIEKFGKSTLKKAEMQEKNPLPSKEMIEEERQTGES*
9 >lcl|XP_594476.2|Plus12983107..2983766 NW_001494824 Tctex1 domain containing 1-like TCTEX1D4 __SEG__ Chr3 {Bos taurus} MAGRPVAPGRQEEEEAKDHGLKLSAARPLGHLPSIDGTRPAGLGPASRRGSVLGPVLSFSRRNSLAGPSAGPGGRRPSLGPVPPLGSRVSFSGLPLAPARRMAPSYRTEP
APGERWETARAQQALEAALAEGLRDACYSGAEAGRLAQELCELVRRRLRELSPPRYKLVCSVVLGQRAGQGVRVVSRALWDAACDGLASAAVTNASLFAVATVHGLYCE*