SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr M    

ID / Description / Sequence
1 >lcl|NP_001124204.1|Plus1complement(462993..464732) NW_003536643 thrombomodulin THBD __SEG__ Chr17 {Sus scrofa} MLRVLLLGVLAPAGLGFPVLPEAQPLGSQCVEHDCFALFRGPATFLAASQACEHLQGHLMTVRSSVAAEVISLLLSGEGDGPRLWIGLQLPRDCVEPRHRGALRGFQWVT
GDNHTSYSMWARPQGDEEPICGTLCVAVSAAGAPVPGEPAWEEQQCEAEADGFLCEFHFPASCQPLAVKSDAAEAASFSITYSTPFGARGADFQALPVGSSVAVTPLGVE
LECAVWPGEAQARWVREAPGAWACGVENGGCQHACNGSAGESRCLCPADAALQEDGRSCEAPAEHPCHRLCEHICFHDPLDAPTNYTCFCEAGYRLAADGHRCEDVDDCA
EVPSPCPQSCVNTQGGFQCHCLPNYELVDGECVEPVDPCFGTDCEYECQVVGRTGYRCVCAEGFAPVPHAPHRCQMFCNQTSCPADCDPNKQDSCQCPDGYILDEGSICT
DIDECNNGYCPGECRNLPGTYECICGPQLDLAGHAGTDCDPIQENSREQGGGDEDVGSGEPAVSPTPGTTARPSPARPLHSGVLAGISIATLSLVVALLALLCHLRKKQG
TSRAELEYKCGVPAKEVVLQHVGQMPQKL*
2 >lcl|XP_001926288.3|Plus1complement(35366..36268) NW_003534837 carbohydrate sulfotransferase 11-like LOC100157186 __SEG__ Chr5 {Sus scrofa} MPHTVLSSGPLVSPLQLDLSNTAVLHQMRRDQVTDTCRASSAMSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLK
TLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNTSFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIH
YDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE*
3 >lcl|XP_003121642.1|Plus1complement(3920404..3921534) NW_003534012 carbohydrate sulfotransferase 14-like LOC100520059 __SEG__ Chr1 {Sus scrofa} MFPRPLTPLAAPNGAEPLGRALRRVPSGRARAGLGAPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPNREGAVWRETVPRSGGLLLDAGDSDLQVRQDVRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGVLDNVDVRLKMDHRSDLVFLADLRPDEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVRYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRP
ASPESLHYHLCSAPRAVLQDVLPKYILDFSLFAYPLPNVTREACHQ*
4 >lcl|XP_003124312.1|Plus1complement(377925..379175) NW_003299647 carbohydrate sulfotransferase 12-like LOC100524793 __SEG__ Chr3 {Sus scrofa} MAKSRLLRLWLVLGSVFMVVLIIVYWDNVGAAHFYLHPARPRPPAPEPRPSGGPAPPRLLPARPLETLLLGGRQPGLAGRPAGQPWPRASRKPGPPGNLEESVRGYDWSS
PAAPQSADPDGRQAERRSVLRELCANASFVFPTKERSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSQSLSDRGVPYRDPLDIPREYVHNSSTHLTFNK
FWRRYGKFSRHLMKIKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLQMYSNHTSPPASVSEAFSAGLRVSFANFIQYLLDPHTEQLAPFNEHWRQVHRL
CHPCQIDYDFVGKLETLDQDAAQLLRLLKVDKLLHFPPSYRNRTASSWEEGWFAQIPLAWRQQLYKLYEADFVLFGYPKPENLLRD*