SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor M    

ID / Description / Sequence
1 >lcl|NP_001012112.1|Plus1complement(31058076..31059056) NW_047762 ankyrin repeat domain 9 Ankrd9 __SEG__ Chr6 {Rattus norvegicus} MPWDTRPGRSANGGPEGPGAARLRVQKQCRKSSFAFYLAVRDLLPVWLLEDMRASEAFHWDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCT
APGPHVALAVRYNRVGILRRILRTVQDFPVEERVRLLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPSLRDGSGFTPLELLLHQLNQDASSAPTAAEAASATV
PAATATTTSSGEVCQRRLLLLDLLALYTPGGIVGPARCELLGDRLRWQRLLGEDKFQWLAGLAPPSLFVRAMQVLVTTISPGRFPEALDELPLPPFLQPLDLSGKG*
2 >lcl|NP_001032864.1|Plus1complement(2559516..2560775) NW_047369 carbohydrate sulfotransferase 12 Chst12 __SEG__ Chr12 {Rattus norvegicus} MTKPRLFRLWLALGSALMILLIIVYWDNVGTAHFYLHTSLSRPHILEPLPTQGLAEENVLASDVDEFLDTLLSSDAKHNDLSRRKTEQPPVLTPSKPVLSHMEENVRGYD
WSTHDAQQNPDRDRQQAERRSLLRDFCANASLAFPTKDRSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSESLLDRGSPYRDPLDIPREHVHNTSTHLT
FNKFWRRYGKFSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASVSEAFSAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQV
YRLCHPCQIDYDFVGKLETLDEDAAQLLRSLKVDSQLHFPPSYRNRTASSWEEDWFANIPLAWRQQLYKLYEADFVLFGYPKPENLLRD*
3 >lcl|NP_001103109.1|Plus146840909..46842036 NW_047657 dermatan 4 sulfotransferase 1 Chst14 __SEG__ Chr3 {Rattus norvegicus} MFPRPLTPLAAPKSAKTLARTPKRAPLGRARAGIGGPPLLLPSMLMFAVIVASSGLLLMIERGILSEMKPLPLHPPSHKGAAWSGTDPKPRGLSFDAEDSDLQVREDIRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGVLNNVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPEHMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPSHVRFPARQAWYRP
ASPESLHYHLCNAPRALLQDVLPKYILDFSLFAYPLPNVTKEACR*
4 >lcl|NP_001128487.1|Plus111864743..11865894 NW_047492 GA binding protein transcription factor, beta subunit 1-like Gabpb1l __SEG__ Chr17 {Rattus norvegicus} MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHW
ATEHIHQEVVELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTDETGVSAVQFGNSSTSVLATLAALAE
ASAPLSNSSETPVVATEEVVTAESVDGAIQQVVSSVGQQVITIVTDGIQLGNLHSIPTSGMGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCMEIIENRVESA
EIEEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMKRLQTNKEAV*