SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro M    

ID / Description / Sequence
1 >lcl|XP_001135840.1|Plus196539..97018 NW_003459168 ankyrin repeat domain-containing protein 58 ANKRD58 __SEG__ ChrX {Pan troglodytes} MHGSQENIILVHEFAPRRGVRLNVSAPGSGGLTPLHMAALQGHDMVIKVLVGALGADATRRDHSGHRACHYLRPDAPWRLRELSGAEEWEMESGSGCTNLNNNSSGTTAW
RAASAVGATAVETSRRVAASRTKAKDTAGSRVAQMHSLFRHLFPSFQDR*
2 >lcl|XP_001164358.1|Plus1complement(7181183..7182136) NW_003457860 ankyrin repeat domain-containing protein 9 isoform 2 ANKRD9 __SEG__ Chr14 {Pan troglodytes} MPWDARRPGGGADGGPEGSGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFHWDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCC
AAPGPHVALAVRYNRVGILRRILRTLRDFPAEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGLTPLELLLRQLGRDAGATPSAAGDPASA
PGEPRQRRLLLLDLLALYTPVGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALDELPLPPFLQPLDLTGKG*
3 >lcl|XP_003310862.1|Plus119147625..19149274 NW_003457058 ankyrin repeat domain-containing protein 43-like LOC471628 __SEG__ Chr5 {Pan troglodytes} MALAAAAAAAAAGVSQAAVLGFLQEHGGKVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKEVDGVKFVVLRKKPRPLEPEPAPFGPPGAAAQPSKPTSTVL
PRSASAPGAPPLVPVPRPVEPPGDLGLPTEPQDTPGGPASEPAQPPGERSADPPLPALELAQATERLSADAAPPPRAPSEAASPCSDPPDAEPGPGAAKGPPQQKPCMLP
VRCVPAPATLRLLAEEPGLRRQLSEEPSPRSSPLLLRRLSVEESGLGLGLGPGRSPHLRRLSRAGPRLLSPDAEEVPAAPPPSAVPLEPSEHEWLVRTAGGRWTHQLHGL
LLRDRGLAAKRDFMSGFTALHWAAKSGDGEMALQLVEVARRSGAPVDVNARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDHSGRRAYQYLRPGSSYALRRLLGD
PGLRGTTEPDATGGGSGSLAARRPVQVAATILSSTTSAFLGVLADDLMLQDLARGLKKSSSFSKFLSASPMAPRKKTKIRGGLPAFSEISRRPTPGPLAGLVPSLPPTT*
4 >lcl|XP_003318271.1|Plus1762930..764174 NW_001237920 carbohydrate sulfotransferase 12 isoform 1 CHST12 __SEG__ Chr7 {Pan troglodytes} MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDRELTADSDVDEFLDKFLSAGVKQSDFPRKETEQPPAPGSMEESVRGYDWSPRD
ARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIPNSELSHLIVDDRHGAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNASAHLTFNKFW
RRYGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASAREAFRAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCH
PCQIDYDFVGKLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD*
5 >lcl|XP_003318837.1|Plus116581654..16583312 NW_003457186 hyaluronan synthase 2-like LOC741588 __SEG__ Chr7 {Pan troglodytes} MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQSLFAFLEHQKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLT
YPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPA
SSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKY
TARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHLWMTYEAIITGFFPFFLIATVIQLLYRGKIWNILLFLLTVQLVGLIKSSFASCLRGNIVMVFMSLYS
VLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIPVSVWFTILLGGVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRRKKGQQYDMVL
DV*
6 >lcl|XP_510310.2|Plus15984755..5985885 NW_003457936 carbohydrate sulfotransferase 14 CHST14 __SEG__ Chr15 {Pan troglodytes} MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGTPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRP
ASPESLHYHLCSAPRALLQDVLPKYILDFSLFAYPLPNVTKEACQQ*
7 >lcl|XP_512129.2|Plus13136499..3137980 NW_003458390 EGF-containing fibulin-like extracellular matrix protein 1-like LOC455416 __SEG__ Chr18 {Pan troglodytes} MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATS
GVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTI
PPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSR
TCQDINECETTNECREDEMCWNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLR
QTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSVLRLTIIVGPFSF*
8 >lcl|XP_525283.2|Plus1complement(587661..589388) NW_003458542 thrombomodulin THBD __SEG__ Chr20 {Pan troglodytes} MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPHGCGDTKRLGPLRGFQW
VTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCDVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGL
QLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTAPATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCI
LEPSPCPQRCVNTQGGFECHCYPNYDLVDGECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPNTQASCECPEGYILDDGFICT
DIDECENGGFCSGVCRNLPGTFECICGPDSALARYIGNDCDSGKVDGGDGGSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLRKKHGAARAKM
EYKCAAPSKEVVLQHVRTERTPQRL*