SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus M    

ID / Description / Sequence
1 >lcl|NP_033404.1|Plus1complement(89273251..89274984) NT_039207 thrombomodulin precursor Thbd __SEG__ Chr2 {Mus musculus} MLGIFFLGVLAPASLGLSALAKLQPTGSQCVEHECFALFQGPATFLDASQACQRLQGHLMTVRSSVAADVISLLLSQSSMDLGPWIGLQLPQGCDDPVHLGPLRGFQWVT
GDNHTSYSRWARPNDQTAPLCGPLCVTVSTATEAAPGEPAWEEKPCETETQGFLCEFYFTASCRPLTVNTRDPEAAHISSTYNTPFGVSGADFQTLPVGSSAAVEPLGLE
LVCRAPPGTSEGHWAWEATGAWNCSVENGGCEYLCNRSTNEPRCLCPRDMDLQADGRSCARPVVQSCNELCEHFCVSNAEVPGSYSCMCETGYQLAADGHRCEDVDDCKQ
GPNPCPQLCVNTKGGFECFCYDGYELVDGECVELLDPCFGSNCEFQCQPVSPTDYRCICAPGFAPKPDEPHKCEMFCNETSCPADCDPNSPTVCECPEGFILDEGSVCTD
IDECSQGECFTSECRNFPGSYECICGPDTALAGQISKDCDPIPVREDTKEEEGSGEPPVSPTPGSPTGPPSARPVHSGVLIGISIASLSLVVALLALLCHLRKKQGAARA
ELEYKCASSAKEVVLQHVRTDRTLQKF*
2 >lcl|NP_067503.3|Plus11840694..1841953 NT_039316 carbohydrate sulfotransferase 12 Chst12 __SEG__ Chr5 {Mus musculus} MTKPRLFRLWLVLGSALMILLIIVYWDNVGTAHFYLHTSLSRPHILEPLPTQGLVEENVFTSDVDEFLDTLLSSDAKHNDLSRRKTEQPPVPAPSKPVLSHMEENVRGYD
WSTHDAHQNPDRDRQQAERRSLLRDFCANASLAFPTKDRSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSESLLDRGSPYRDPLDIPREHVHNTSTHLT
FNKFWRRYGKFSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASVSEAFSAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQV
YRLCHPCQIDYDFVGKLETLDEDAAQLLRFLKVDSQLHFPPSYRNRTASSWEEDWFANIPLAWRQQLYKLYEADFVLFGYPKPENLLRD*
3 >lcl|NP_082393.3|Plus159793690..59794820 NT_039207 carbohydrate sulfotransferase 14 Chst14 __SEG__ Chr2 {Mus musculus} MFPRPLTPLAAPKSAETLGRTPRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILSEMKPLPLHPPSHKGAAWSGTDPKPRGLSLDAGDSDLQVREDIRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGILNNVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPEHMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRP
ASPESLHYHLCNVPRALLQDVLPKYILDFSLFAYPLPNVTKEACHQ*
4 >lcl|NP_473383.1|Plus12068126..2070423 NT_082868 endosialin precursor Cd248 __SEG__ Chr19 {Mus musculus} MLLRLLLAWVAAVPALGQVPWTPEPRAACGPSSCYALFPRRRTFLEAWRACRELGGNLATPRTPEEAQRVDSLVGVGPANGLLWIGLQRQARQCQPQRPLRGFIWTTGDQ
DTAFTNWAQPATEGPCPAQRCAALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALPLEVGQAGPAVYTTPFNLVSSEFEWLPFGSVAAVQCQAGRGASLLCVKQPSGG
VGWSQTGPLCPGTGCGPDNGGCEHECVEEVDGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYV
GGFECYCSEGHELEADGISCSPAGAMGAQASQDLRDELLDDGEEGEDEEEPWEDFDGTWTEEQGILWLAPTHPPDFGLPYRPNFPQDGEPQRLHLEPTWPPPLSAPRGPY
HSSVVSATRPMVISATRPTLPSAHKTSVISATRPPLSPVHPPAMAPATPPAVFSEHQIPKIKANYPDLPFGHKPGITSATHPARSPPYQPPIISTNYPQVFPPHQAPMSP
DTHTITYLPPVPPHLDPGDTTSKAHQHPLLPDAPGIRTQAPQLSVSALQPPLPTNSRSSVHETPVPAANQPPAFPSSPLPPQRPTNQTSSISPTHSYSRAPLVPREGVPS
PKSVPQLPSVPSTAAPTALAESGLAGQSQRDDRWLLVALLVPTCVFLVVLLALGIVYCTRCGSHAPNKRITDCYRWVTHAGNKSSTEPMPPRGSLTGVQTCRTSV*
5 >lcl|NP_780416.2|Plus1complement(23167836..23168816) NT_166318 ankyrin repeat domain-containing protein 9 Ankrd9 __SEG__ Chr12 {Mus musculus} MPWDTRPGRSANGGPEGPGAARLRVQKQCRKSSFAFYLAVRDQLPVWLLEDIRASEAFHCDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRCALAPPSAGFRCCT
APGPHVALAVRYNRVGILRRILRTVQDFPVEERVRLLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGSGFTPLELLLRQLNQDASSAPTKAEAASATV
NAATANTTSSEEVCQRRLLLLDLLVLYTPGGVVGPARCELLGDQLRWQRLLGEDKFQWLAGLAPPSLFVRAMQVLVTTISPGRFPEALDELPLPSFLQPLDLTGKG*
6 >lcl|NP_780479.1|Plus1complement(16943723..16946005) NT_109320 ankyrin repeat domain-containing protein 56 Ankrd56 __SEG__ Chr5 {Mus musculus} MAGELSQEALLDFLCQAGGRVRNAELLSHFKSFLRDPHVSPGQLQERRERFKGFVNSVAAVRQDPDGTKYVVLKRRYRDLLGEEGLQRPGPVDGKPRGHRRRDPEPQKPP
AGAGTQVDVGGSAQKVAGPDPSPEDSPNQRTPEPEAAQARGRCAAVGTRGRCCWECQQNGWGQSTGQPLPEDLGDPAVACEKPERAAPARDDLGAPGWLREGEAAEHAPG
SVPPVWPPTAVEAAGSPTSPPALPPHPAPSREPLELFTAGSPNHSTQQLQQQHQRTQEWVARYLQVPEPEIQAPTRAWSVLPDNFLQLPSETAFGVSETSSALPEPALSF
HSLLPVVLDESSESWPGNAPSTVFRSIRCQLSLQDLNDFVEQESHGSEESSSGPKESPGTPEEGLQPVLRTSSWGELRDPVEDLFLPPNDSPCLIRRDLGYRGNAPSFRK
VPTVAKSLGDHPQEPFPALKFRRSVRRSSRTGRTKSPSSSDEEHPDEDLWKRSRRPPRSRKPSKAGALPSPRVDAVLVQKLADANAVASQPHSSWIPSRDGSAALIPHRP
SEHRSPLVPLDTREHEWIVRLASGSWLHVLTLFWEDPQLALHRDFLTGYTALHWIAKHGDLCALQDLVSGAQKAGIALDVNVRSSCGYTPLHLAAIHGHQGVIKLLVQRL
ASRVNIRDCSGKKPWQYLNSNVSGETWQLLGAPRGKPIFPVYSLVQSSSPARKVKSREVSRNVTRKTSLAALLKTQHNKWKLASQYEKIHTSKEREEYSD*
7 >lcl|NP_898996.2|Plus1complement(18796641..18798287) NT_096135 ankyrin repeat domain-containing protein 43 precursor Ankrd43 __SEG__ Chr11 {Mus musculus} MALAAAAAAAAAAAGVSQAAVLGFLREHGGQVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKELDGVKFVVLRKKPRPPEGPEAPLPSSPGVPAALAQCAA
VPAEDNCAPGAPHSPQRSGEPPEDSSAPSELQHTPETLPSEVTQVEAPSGSAPQPGGPEDPALPRSSELARPASVPSGLALTSTESPGPEPAPPTAQVPPQKPCMLPVRC
VVPGPAALRIRAEEQGLRRQRSEEPSPRGSPMLLRRLSVEESGLGLHLGPGRSPHLRRLSRAGPRLLSPDTEEMPVAPLPSPAVPLEPTEHEWLVRTASGRWSHQLHGLL
LRDRGLAAKRDFMSGFTALHWAAKNGDREMALQLVEVARRGGAPVDVNARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDYSGRRAYQYLRPGSSYALRRLLGDP
GLRSMMEPDAASGGSGSLVSRHPVQVAATILSSTTSAFLGVLADDLMLQDLARGLKKSSSFSKFLGASPMAPRKKTKIRGGLPSFTEISHRSTPGPLAGLVPSLPPPT*