SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul M    

ID / Description / Sequence
1 >lcl|XP_001094413.1|Plus13760804..3763185 NW_001118147 ankyrin repeat domain-containing protein 56-like LOC699245 __SEG__ Chr5 {Macaca mulatta} MARELSQEALLDFLCQAGGRVTNAALLSHFKSFLRDPDASPSQHQHRRELFKGFVNSVAAVRQDPDGTKYVVLKRRYRDLLGEEGLQRPREPPAAPHSAGGAAPCSPRGA
RGGQSPQQQPRRRRREKEPEEEPAGAAARAADAACNGLPVSGSRAAPGKGGGSKGSPGQRAPVPATAAAGAQAGARCAAAGAQGHCCWECLQNNLAGLPGELGALPDSAT
AEEKPARALPAQDGRGASREPEEGALAEPAPVPATHRSPLATVEAATSRASPPALLPGPAPRGDRPELLTPSSLHYSTLQQQQQRTREWVARHPQVPEARDQGPVRAWSV
LPDNFLQLSLEPGSTEPNSEPPDPRLSSHSLFPVVPDEPWESWAGNPSLTVFRSIRCQLSLQDLDDFVDQESHGSEESSSGPKDSPGASEEGLQVVLGTPVRGKLRNPAG
GLSVSRKEGRPSWSPQDLRNRGDGHISQQVPAGANGLAGHPLEPLPWPVPKLRRSLRRSSLAGRAKLSSSDEEYLDEGLLKRSRRPPRSRKPSKAGTAPSPRVDAALSPK
LAEVKAVVAERGWRHSLWAPSGEGPAAWAPHRTSEHKSSLVPLDAREHEWIVKLASGSWIQVWTLFWEDPQLALHKDFLTGYTALHWIAKHGDLRALQDLVSGAKKAGIV
LDVNVRSSCGYTPLHLAAIHGHQGVIKLLVQRLASRVNVRDSSGKKPWQYLTSNTSGEIWQLLGAPRGKPIFPVYPLVGSSSPTRKAKSKEISRSVTRKTSFAALLKSQH
NKWKLANQYEKFPSPREREEYSD*
2 >lcl|XP_001096685.1|Plus15926054..5927184 NW_001121149 carbohydrate sulfotransferase 14 CHST14 __SEG__ Chr7 {Macaca mulatta} MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPGREGAAWRGKAPKPGGLSLSAGDADLQVRQDVRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPQVQFPARQAWYRP
ASPESLHYHLCSAPRALLQDVLPKYILDFSLFAYPLPNVTKEACQQ*
3 >lcl|XP_001109292.2|Plus111..349 NW_001099808 mitochondrial inner membrane protein-like LOC717606 __SEG__ Chr13 {Macaca mulatta} MIDETRNSLYQYFLSYIQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQ
PE*