SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom M    

ID / Description / Sequence
1 >lcl|XP_001362458.1|Plus1116452..117711 NW_001581978 carbohydrate sulfotransferase 12-like LOC100010103 __SEG__ Chr6 {Monodelphis domestica} MTKMRLLRLWIVLGSVFMILLIIVYWDNVGTAHFYLHTSFSRPHPPGALPTTGKDEEREFVSDVDEFLDKLLSSSGRQNDPLRKKTEQPPLPGSSKPILGNMEENVRGYD
WSTHDAKQNPDQEKLQAERRNMLREFCANSSLVFPTKNRSFDDIPNYELNHLIVDDRHGIIYCYVPKVACTNWKRVMIVLSESLLDQGIPYKDPLDIPREHVHNTSTHLT
FNKFWRRYGKFSRHLMKIKLKKYTKFLFVRDPFVRLISAFRSKFELENDEFYRRFAVPMLKLYSNHTSLPTSVSEAFSAGLKVSFSDFIQYLLDPRTEKLAPFNEHWRQV
YRLCHPCQIDYDFVGKLETLDEDAAQLLQLLKVDKQLHFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLKD*
2 >lcl|XP_001363433.2|Plus11151689..1154217 NW_001581966 ankyrin repeat domain-containing protein 56 ANKRD56 __SEG__ Chr5 {Monodelphis domestica} MAQELSQEELLDFLCQAGGRVTNAALLGHFKHFLRDPSAAPGQLQQRRELFKSFVNSVAAVRQDPDGTKFVVLKKRYRDLVGEEGLRGHRGSQLAKAPPQPQTPRPPRAP
TAFPGSLRPAPRLRQQSQPQQQQPQTQTEPQPRLQPQPQPHLYQPRPQEYQQQPQPQEQQPQRARRQPREKEPETVPAGARAAAPETEYNGLWPRAADAPGSAEVGRGGG
GSCSPRRLGEAASPKGLVPQTRVRCTAAGTQGGSCWECAQDSPWVGSTEPLLSHLEEQQALEASSGQPLEGIPNSSSSLSFQPSPVATALLPPQETCRASVTSPSLASPL
VFPEDGAGLLTRSGPHSYVAQQQLRTREWVANHSQPSPGSVAEKTHQGPSRSWCVLPENFPQQPNNWGHLASERLPPPLPASSLQLSAGSSIFRSIRCQLDLQNLENFVE
EDSHDSEESTSGPRESPGELEDTPKVSLENGDQENPRTQAGHFIQSQQENLFLNKSQGLIFQNGHSLQHIPGRVNGPLVISTKTSRESFSQSQDSMPWPIPRLKRSLRRS
SRAGRDKISSSDEELLDEDLVKRNRRPPRSRKMSRVGTVPCPKVDAPLALKPTNIKASSEQRLADSIWVPPGNVSSVLVSLRPSVHKSSLVPLDSREHEWIVRLASGSWV
QALTLFWEDPQLALRKDFLTGYTALHWIAKHGDLQALQDLVKGAQKTGIILDMNVRSSCGYTPLHLAAIHGHQGIIKLLVQRLESSVNVRDSSGKKPWQYLTSSTTGEIW
QLLGAPKGKPIFPVYSLVSSSPSRKAKSHDVSRNISRKTSFAALLKSQHSRWKMAHQYDKFRSSGEREDYSD*
3 >lcl|XP_001368027.1|Plus114799413..14800249 NW_001581968 phospholipid scramblase 2-like LOC100013654 __SEG__ Chr5 {Monodelphis domestica} MYKGTLRISGSGAGPFGFPAHQQPVAFSNKPHPNIFLPTKMIPPPPEMIPPPRPINCPPGLEYLSVLDNLLIFQQIEFLEALTGFETNNRYEIKNLFGQRIYYAVEENDF
CTRNCCGSLRPFVIKILDYSSHEVIHIERPLKCASCYFPCCLQKLEIQSPPGSPIGYIVQKWHPFLPKFTVLNERHEKVLTIVGPYIVSSCFSNIDFNIKSLNEKVIVGK
ITKQWSGFFKETFTDADNFSIQFPLDLDVKMKAVMLGACFLIDLLFFEVGGTKAGVWC*
4 >lcl|XP_001370777.1|Plus170300996..70302132 NW_001581861 carbohydrate sulfotransferase 14-like LOC100027325 __SEG__ Chr1 {Monodelphis domestica} MFPRPLTPLTAQKGPEPLGRPSRRSPPGGGRGRGGFGGPPLLLPSMLMFGVIVASSGLLLMIERGILAEMKPPPLHPHGRMDPVWRKGVAGGPGMALDPGDSDHQVRQDV
RNRTLRAICGQPSMPRDPWDLPAGQRRTLFRHILVSDQYRFLYCYVPKVACSNWKRVLKVLAGALDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPMER
LLSAYRNKFGEIREYQQRYGAEIVRRYRLGAGPSPAGDDVTFPEFLRYLVDEEPERMNEHWMPVYQLCQPCAVHYDFVGFYERLEVDANHVLEWVRAPPTVRFPSRQAWY
RPASPESLHYHLCNTPRALLQELLPKYILDFSLFAYPLPNVTREACRQ*
5 >lcl|XP_001372000.2|Plus116233035..16234660 NW_001581837 ankyrin repeat domain-containing protein 43-like LOC100019013 __SEG__ Chr1 {Monodelphis domestica} MALAAAAAAAAAGVSQAAVLGFLQERGGKVRNSELLSRFKPLLDAGDPGGRAARRDWFKRFVNDVAVVKEQDGVKFVVLRKKLRASGTPRPAPPTPSAGAGTPLPEDPPT
SSPQELAAGPQTESPTQAPSDPDADPEYASPSPPSEEGPQSRSEPGALAPAPAQEEGAVDAIPDSLALAPALPSRNMPTALPKSLAVPEELPPLKPRKPCMLPVRCVPSV
VRIRAEEQGLRRQLSEEPAVAASSLLLVPGDSPRLRRRLSVEETGLALGGRSPHLRRLSRAGPRLLSPEAEEPLSAIPQPPPTVPLEPAEHEWLVRAAGGRWTHQLHGLL
LRDRSLATKRDFMSGFTALHWAAKSGDREMALQLVEVARRGGAPVDVNARSHGGYTPLHLAALHGHEDAAILLVERLGAQVRVRDHSGRRAYQYLRPGASYALRLLLGDP
ALRGPTEHGGPAKRPVQVAASILSSTTSAFLGVLADDLMLQDLARGIRKSGSFSKFLGPSPLVPRKKAKARPGLPTFPSASAQASTTGSKRWPGTDLFQGH*
6 >lcl|XP_001373754.1|Plus122687649..22688557 NW_001581837 ankyrin repeat domain-containing protein 9-like LOC100021676 __SEG__ Chr1 {Monodelphis domestica} MPWDVKRQGGGLDGPSQSRAQKQCKKSSFAFYQAVRDLLPVWFLEDMRATEAFHWEEGGRASTYSPSEALLYALVHDHQPYAHYLLAKFPRGALAVPSRNFSCCQSSSPH
LALAVRYNRVHILRRILRTIRDFPDEERTHYLDRRGCSRVEEGKTSLHVACELARPECLFLLLGHGASPGLCDGAGNTPLDLLLRRVGQDTAAPAAAPAAGDPLALLDLL
FLYMPPGSASPMQRELLGDRVRWQRLLGEEKFQWLAGLAPPSLFARAMQALVRSISPRRFPEALDELPLPPFLQPLDLKLKS*
7 >lcl|XP_001374032.1|Plus138146409..38148493 NW_001582020 protein SPT2 homolog LOC100022062 __SEG__ Chr8 {Monodelphis domestica} MDFRDILTVASEKQGLNIIPKRYSLAVNPPKRDPKVKGVQSAAVQAFLKRKEEELRKKALEEKRKKEELVKKRIELKHDKKARAMAKRTKDNFYGYDGIPLEEKAKKKHG
IEGPTGQEADQECSNEDDTEPPLEYYQTESENEEYEEQEAPLKTITKPKAPLRSAPPPMNFTDLLRLAEKKQYEPVEIKVVKKIEERPRTAEELREKEFLERKHKNIDRG
KEKKMLEREKRLIPPTMSKKVPSSKESVSERHRGPGDKHSSSRGRHLTHIGAEKKSRSSATTEKTMRLPSSKSQPGERTKASSGDTFQHSPSESHSLLLNGSGKSHSSSH
SMGTGISKTMVHGTQKSNGHRPSKSPSSHPSHSKSGVVSTPHEKTRNLGAKQPGNSSNSTSGRPGVGTAWPVQSPSPRKHSGSSISGPEQQISGSKRLVGGSGPSGRLVS
GSSGRGHPTSNLGSFGRPLSGTSSTGQTVTPVRRPVSGLSGPGQPSSGGPGRPISNSGGPGRPSSSSGGSGRLSSNSGGPGRPASGSGGPEQTVSGSGPSVKPRCTVVSE
TISSKNIISRPSNGMVNGMRPPPPGYRPAVYPQGAQRHPFPPMARKRYLEEDEDEEYDSEMEDFIDDGEPQEEISKHIREIFGYDHNKYKDESDYALRYMESSWKEQQKE
EAKSLRLGMQEDLEEMRREEEELKCQKAKKMKLR*