SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab M    

ID / Description / Sequence
1 >lcl|XP_001492298.2|Plus1complement(4744725..4745984) NW_001867371 carbohydrate sulfotransferase 12-like LOC100059762 __SEG__ Chr13 {Equus caballus} MAKARLFRLWLVLGSVFMILLIIVYWDNVGTAHFYLHTSFSRPHPLEGLPTAGQREEKELPADVDEFLEKLLSGGAKQNVVSGKKLEQPSLLASGRPVLSNVEERIRGYD
WSTHGAQQSPDLDRRQAERRSVLRELCANASFVFPTKERSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSESLLDQGAPYRDPLDIPREYVHNSSTHLT
FNKFWRRYGRFSRHLMKIKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLKMYSNHTSLPASVSEAFSAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQV
HRLCHPCQIDYDFVGKLETLDQDAAQLLRLLKVDKLLHFPPSYRNRTASSWEDDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD*