SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam M    

ID / Description / Sequence
1 >lcl|NP_001006954.1|Plus1597369..599105 NW_876277 thrombomodulin precursor THBD __SEG__ Chr24 {Canis lupus familiaris} MLRVLLLGVLAPAGLGLPTPAQPQPRSSQCVEHDCFQLFRGPATFLAASQTCEGLGGHLMTVRSSVAADVISLLLSGDGGDGPRLWIGLQLRRGCSDPGQGGPLRGFQWV
TGDNRTSYSRWARPHVGPAGPPCAPLCVAVSDAAAPAPGEPAWEEQRCAAEADGFLCEFHFAASCRPLLVDARAAAAAGVSVTYSTPFGARGADFQALPAGSSAAVAPFG
VQLACAAPRGEAEARWGREAPGAWDCSVENGGCQRACSASAGAPRCLCPADTYLQADGRSCATFAEHSCHKLCEHFCIPNASVPGSYLCMCETGYQLAADQHRCEDVDDC
IQVPSLCPQLCVNTRGAFECHCYPGYELVDNECVEPVDPCFGSKCEYQCQPVSQTDYRCICAEGFAPVPHDPHRCQMFCNQTACPADCDPNSPTSCQCPEGYILDDGFMC
TDIDECENGECPEACRNLPGTYECICGPDSPLAGQVATDCGRIISDPDGDSDSGSGEPPVTPTPGVTPSPSPVGPVHSGVLIGISIASLSLVVALLALLCHLRKKQGAPR
AELEYKCGAPAKEVVLQHVRTEQMPQKL*
2 >lcl|XP_003432515.1|Plus122385916..22386524 NW_876267 heparan-sulfate 6-O-sulfotransferase 1-like LOC100688113 __SEG__ Chr19 {Canis lupus familiaris} MCDGRTPTPEELPPCYEGTDWSGCTLQEFMDCPYNLANNRQVRMLADLSLVGCYNLSFIPEGKRAQLLLESAKKNLRGMAFFGLTEFQRKTQYLFERTFNLKFIRPFMQY
NSTRAGGVEVDEDTIRRIEELNDLDMQLYDYAKDLFQQRYQYKRQLERREQRLKSREERLLHRAKEALPREDADEPGRVPTEDYMSHIIEKW*
3 >lcl|XP_540833.1|Plus125695615..25697933 NW_876266 endosialin CD248 __SEG__ Chr18 {Canis lupus familiaris} MLLRLLLAWAAAAPTLGQAPWAAEPRAVCGPGSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGPGPASRLLWIGLQRQARQCQPQRPLRGFTWTTGDQ
DTAFTNWAQPATGAPCPAQRCAALEASGEHRWLEGSCTLAVDGYLCQFGFEGSCPALLGEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVPCQAGREASLLCVKQPEGG
VGWSRAGPLCPGTGCGPDNGGCEHECVEEVDGRVSCRCTEGFRLAADGQSCEDPCAHAPCEQQCEPGGPQGYSCHCRLGFRPAEDEPHRCVDTDECQIAGVCQQMCVNYV
GGFECYCREGHELEADGISCSPAGAMGARASQDLGDELLDDGDDEEDEHEAWETFDGSWTEVPGIPWMEATQPPDFGLAYRPSFPEDREHQMPYLDPTWPPPLSAPRVPY
HSSVLSVTRPVVVSATRPTLPSAHRPSIISATRPPLAPAPEPPMIPDKHPALPPDHQFPMISANHPDLSSAYQPPIISATHPAWPPAHQPPVISAKHPQLSPGHQSPVFP
DTQVTDTQATAHLPQIPANHTPPVATPNTHQSLVTPDVLDLKGQATHLPLTSTVQPPLTTTPRPPVLPAHQVPVPAATQAPGLHTTLTSEPPGSPTNHTSLTSPTYPHSK
PSQVPREGAHDSKVAPWLPSAAPTALGEASMAGHSRRDDRWLLVALLVPTCVFLVVLLALGIVYCTRCGPHAPNKRVTDCYRWVTHAGSKGPTESMPHRGSLTGVQTCRT
SV*
4 >lcl|XP_547987.3|Plus1complement(68326649..68327620) NW_876327 ankyrin repeat domain-containing protein 9 ANKRD9 __SEG__ Chr8 {Canis lupus familiaris} MPWDARRPGGSADGGPEGAGAARSRAQKQCRKSSFAFYQAVRDLLPVWFLEDMRASEAFHWDERGRAAAYSPSEALLYALVHDHRAYAHYLLATFPRRALAPPSAGFRCC
AAPGPHVALAVRYNRVGILRRILRTVRDFPPDERARLLDRRGCTRVEGGGTALHVACELARPECLFLLLGHGASPGLRDGGGLTPLELLLRHLGRDAGAASAAGTPGTAG
TPAAPGEPRQRRLLLLDLLALYAPAAHAAAGPARRELLGDRPRWQRLLGEDKFQWLAGLAPPSLFVRAMQVLVTAISPGRFPEALDELPLPPFLQPLDLTGKG*
5 >lcl|XP_852023.1|Plus1complement(5853686..5854945) NW_876318 carbohydrate sulfotransferase 12 CHST12 __SEG__ Chr6 {Canis lupus familiaris} MTKTRLFRLWLVLGSVFMVLLIIVYWDNVGTAHFYLQTSFPRPHPLEPLPTPGHGAEKEFTSDVDAFLQKLLGGSLKQSPLSGKRPEQPSVPASSRPGLSNAEESVRGYD
WSARDTQQGPDPGGQQAERRSVLRGLCANASFVFPTKERSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSESLLDRGTPYRDPLDIPREYVHNSSTHLT
FNKFWRRYGKFSRHLMKIKLKKYTKFLFVRDPFVRLISAFRSKFQLENEEFYRKFAVPMLKMYANRTGLPASVSEAFSAGLKVSFANFIQYLLDPRTEKLAPFNEHWRQV
HRLCHPCQIDYDFVGKLETLDQDAAQLLRLLKVDKVLHFPPSYRNRTASSWEEDWFATIPLAWRQQLYKLYEADFVLFGYPKPEHLLRD*