SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau M    

ID / Description / Sequence
1 >lcl|NP_001091481.1|Plus11547477..1548607 NW_001492809 dermatan 4 sulfotransferase 1 CHST14 __SEG__ Chr10 {Bos taurus} MFPRPLTPLAAPEGAEPLGRALRRAPLGRARPGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPNREDAVWRGTVPRPGRLSLDAGNSDLQVRQDVRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGVLDNVDVRLKMDHRSDLVFLADLRPDEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGVEIVKRYRAGAGPSPAGDDVTFPEFLRYLADEDPERMNEHWMPVYHLCQPCAVRYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRP
ASPESLHYHLCSAPRALLQDVLPKYILDFSLFVYPLPNVTREACHQ*
2 >lcl|NP_001159994.1|Plus1282453..284189 NW_001493131 thrombomodulin THBD __SEG__ Chr13 {Bos taurus} MLRVLLLGVLAPAGLGLPAPPEPQPLGGQCVDLDCFAVFRGPATFLAASRVCERLQGHLMTVRSSVAEDVISLLLSGDGPRLWIGLQRPPGCDDPEHSGPLRGFQWVTGD
NRTSFSRWARPHDDGARLCGPLCVAVSAAAGALAPGEPAWEERPCDAEADGFLCEFHFAASCRPLAVDPGATAAAGLSITYGTPFGARGADFQALPLGSTAAVAPLGVEL
ECAAQPGETEGRWSREAPGAWACGVERGGCQHECKGSAGASNCLCPADAALQADGRSCGLPAEHPCHQLCEHFCHLHGLGNYTCICEAGYQLAADQHRCEDVDDCAQLPS
PCPQRCVNTEGGFQCHCDTGYELVDGECVDPVDPCFDNNCEYQCQPVGRSEHKCICAEGFAPVPGAPHKCQMFCNQTSCPADCDPHYPTICRCPEGYIIDEGSTCTDINE
CDTNICPGQCHNLPGTYECICGPDSALSGQIGIDCDPTQVNEERGTPEDYGGSGEPPVSPTPGATARPSPAPAGPLHSGVLVGISIASLSLVVALLALLCHLRKKQGASR
GELEYKCGVPAKELMLQQVKTERTPQKL*
3 >lcl|XP_580366.1|Plus1585579..587237 NW_001495088 hyaluronan synthase 2 LOC504273 __SEG__ Chr5 {Bos taurus} MHCGRLLCILRIIGTTLFGVSLLFGITAAYIVGYQFFQTDNYYFSFGLYGAVLVSHLVIQSLFAFLEHQKMKKSLETPVKLNKTVALCIAAYQEDPGYLRKCLQSVKRLT
YPSIKVVMVIDGNSEDDLYMMDIFSEVMGRDMSATYIWKSNFHMKGPGERNESHKESSQHVTQLVLSSKNICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTILDPA
SSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLQEFVEDWYNQEFMGSHCSFGDDRHLTNRVLSLGYATKY
TARSKCLTETPKEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHLWMTYEAVITGFFPFFLIATVIQLFYRGKTWNILLFLLTVQLVGLIKSSFASCLRGNTIMVFMSLYS
MLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNLIGLIPVTIWFTILLGGVVFTIYMESKKPFSESKQTVVIVGTLLYVCYWVLFLTLYVVVIKKCGRQRKGPQYSVAL
DV*
4 >lcl|XP_610387.2|Plus1complement(1086433..1087404) NW_001508689 hypothetical protein LOC531884 __SEG__ ChrX {Bos taurus} MPCPFPDSTYVSYSPDHWPLCFVHRNFHYITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMDCPYNLANNRQVRMLSDLTLVG
CYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKTQYLFEKTFNMNFISPFTQYNTTRASSVEINDELQKRIEGLNFLDMELYSYAKDLFLQRYQFMRQKEHQEAR
RKRQEQRKFLKGRFLQTHYQTQSQGQNPNPSQNPSQNPNLNASQSGTQNLFQNLIQNLTQSSGQNPSPKENQESQKQNSGQEQSDGNTSNGTHDYIGSVEKWR*