SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr L    

ID / Description / Sequence
1 >lcl|NP_001005351.2|Plus1complement(441821..442003) NW_003299342 interferon-stimulated gene 20 kDa protein ISG20 __SEG__ Chr1 {Sus scrofa} ILQLLKGKLVVGHDLKHDFKALKENMSNYTIYDTAQDRLLWREADLHYCRRVSLRLLSQRL
2 >lcl|NP_001116656.1|Plus1complement(34610..37741) NW_003299480 V(D)J recombination-activating protein 1 RAG-1 __SEG__ Chr2 {Sus scrofa} MAVSLPPTLGLSSAPDEIQHPHIKFSEWKFKLFRVRSFEKAPEKAQTEKQDSSEGKPSLEQSPAVLDKPGGQKSALPQPAFKPHPKFLKESHEDGKARDKAIHQANLRRL
CRICGNSFNTTGHKRRYPVHGPVDGKTQVLLRKKEKRATSWPDLIAKVFRIDVKADVDSIHPTEFCHNCWSFMHRKFSSTPCEVYSPRNATMEWHPHTLNCDICHIARRG
LKRKSQQPNMQLSKKLKTVIDRARQARQRKRRAQARISSKELMKKIANCGQIHLSPKLLAVDFPAHFVKSISCQICEHILADPVETSCKHVFCRICILRCLKVMGSSCPS
CHYPCFPTDLESPVKSFLSILNTLMVKCPAKECNEEISLEKYNHHISSHKESKETFVHINKGGRPRQHLLSLTRRAQKHRLRELKLQVKAFADKEEGGDVKSVCLTLFLL
VLRARNEHRQADELEAIMRGQGSGLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHPFEWQPPLKNVSSSTDVGIIDGLSGLSSSVDD
YPVDTIAKRFRYDSALVSALMDMEEDILEGMRAQDLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPVVPEKAVRFSFTVMKITIAHGSQNVKVFEEAKPNSELCCKPLCL
MLADESDHETLTAILSPLIAEREAMKSSQLMLEMGGILRTFKFIFRGTGYDEKLVREVEGLEASGSVYICTLCDATRLEASQNLVFHSITRSHAENLERYEVWRSNPYHE
TVDELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEAYKNPHASKEERKRWQATLDKHLRKKMNLKPIMRMNGNFARKLMTKETVEAVCELIPSEERHE
ALRELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKYYEMEDV
LKHHWLYTSKYLQKFMNAHKAFKNSGFTINLQRSSGDTLDLENSPESQDLMEF*
3 >lcl|XP_001926820.1|Plus1complement(221847..222791) NW_001885312 three prime repair exonuclease 1-like LOC100155669 __SEG__ Chr13 {Sus scrofa} MGSQALPQAPVQTLIFLDLEATGLPFSQPKVTELCLLAVHRCALESLPIPQGPSPTVPPPPRVLDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQYFDANLANLLRA
FLQRQPQPSCLVAHNGDRYDFPLLQAELAMLGLASALDDTFCVDSIAALKALEQADGSSEHGPRKSYSLGSIYTRLYGQAPPDSHTAEGDVLALLSICQWRPRALLRWVD
VHARPFSTVKPMYVVTASTGTNPRPSAAKATVLLAKARNTSPNLGGDRSPKPLSPMKSPGTPPREGLLAPLGLLAFLTLAVATLYGLSIAIPGH*
4 >lcl|XP_003121422.1|Plus1complement(398359..399534) NW_003533967 testis-specific Y-encoded-like protein 1-like LOC100518283 __SEG__ Chr1 {Sus scrofa} MAETGEESLAPVTQPQLQLPEERGAPQAAPPDPSCARATQPRGGGDCGAGQEQAPPPAEGLETASKALATGGSLGNGGRRGELHGPEGKKAMEAGGAEKLGSEAMAEAKA
EDVKTEEGPASSVPVLEEVAGKEGAQAVEAVDQQMEVEEQSVGEEIEMVENRVVVEEERARAGYRPLRLDLRMNPLEAIQLELDTVNAQADRAFQQLEHKFGRMRRHYLE
RRNYIIQNIPGFWVTAFRNHPQLAPMIRGQDAEMLRYITNLEVKELRHPRTGCKFKFFFRRNPYFRNKLIVKEYEVRASGRVVSLSTPIIWRRGHEPQSFIRRNQEVVCN
FFTWFSDHSLPESDRIAEIIKEDLWPNPLQYYLLREGVRRVRRRPIREPVEIPRPFGFQSG*
5 >lcl|XP_003121426.2|Plus1complement(381888..383132) NW_003533967 testis-specific Y-encoded-like protein 4-like LOC100520347 __SEG__ Chr1 {Sus scrofa} MSGLDEGDNLPVAQTCGPATPDHAPGHPNPKQCQGEESEATLVMADSGESGLQSAAEGGEPRDPAGCGLALRVRVAGNRGRVATKAGQKEAPASTEGLEAASASASIAAD
SSQENGCQRRELRIPAVEKALEACGAGRLGSQMIPGAKAKEMMMKKGTVSTAAEKEGVAEEVVEEKKVMLKDKKVVGGAKEETRARAPKINNCMDSLEAIDQELSNVNAQ
ADRAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMMRYMINLEVEELKHPRAGCKFKFIFQSNPYFRNEGLVKEYERRSSGRVVSLSTPI
RWHRGQDPQSHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKAELWPNPLQYYLMGDGPRRGFRDPVRQPVESPRTFRFQSG*
6 >lcl|XP_003122675.1|Plus1425348..426490 NW_003534211 flap endonuclease 1-like isoform 1 LOC100517749 __SEG__ Chr2 {Sus scrofa} MGIQGLAKLIADVAPGAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQ
LQQAQAAGAGEEVEKFTKRLVKVTKQHNDECKHLLSLMGVPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRVLQELGLNQ
EQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAQQLFLEPEVLDPEAVELKWSEPNEEELVKFMCGEKQFSEERIRSGVRRLSK
SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSAKKKAKTGAAGKLKRAK*
7 >lcl|XP_003122679.1|Plus1complement(763401..764543) NW_003534211 flap endonuclease 1-like isoform 1 LOC100518534 __SEG__ Chr2 {Sus scrofa} MGIQGLAKLIADVAPGAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQ
LQQAQAAGAGEEVEKFTKRLVKVTKQHNDECKHLLSLMGVPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRVLQELGLNQ
EQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAQQLFLEPEVLDPEAVELKWSEPNEEELVKFMCGEKQFSEERIRSGVRRLSK
SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSAKKKAKTGAAGKLKRAK*
8 >lcl|XP_003123052.2|Plus11212147..1214231 NW_003534259 zinc finger BED domain-containing protein 5-like isoform 1 LOC100525805 __SEG__ Chr2 {Sus scrofa} MIAHLLCILSYNFNTFVILNVYSKLTMFCTTNTLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQSEDEQLQPSVSKNSEGELSRVKFMSNSNKITTFSKKPKRRK
YDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIK
PCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQ
KHEIEWEKCVDVCSDASRAMDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGK
VLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNMSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINSTVDKDICSAI
VQHLRGLRSTLLKYFPVTNDSNAWVRNPFTVTVKPTSLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPGIARRAVRVLLPFATMHLCETGFSYYAATKTKYR
KRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH*
9 >lcl|XP_003129823.1|Plus1131476..133404 NW_003535525 lysine-specific demethylase 4D KDM4D __SEG__ Chr9 {Sus scrofa} MTSRPCGVQNPGCAIMTFYPTLEEFEDFSQYIAYMESQGAHHAGLAKVIPPKGWKARQTYEDISDIVIAAPLQQVAFGEAGVFTQYHRKKRAMTVSQYHHLAHTVKYQAP
PHLDFEDLEQTYWKTRLYGSPIYGADVSGSLFDENTKQWNLGHLGTIQDLLEQECGVAIDGVNSPYLYFGMWKTGFAWHTEDMDLYSLNFLHFGEPKTWYAVPPAHGRRL
ERLARELFPGPARGCEAFLRHKVALISPTVLKAQGIPFGRVTQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATPRWVDYGKVASQCSCGEARVVFSMDAFVRILQPERY
ELWKRGQDRVALEHTEHLSSPGSLELSAWREVREPAGAELGLGHSPPHTARGRLWVAGRGIRRRNSVCSVSRCPSPTWGSSSAAQFQVATLCSSHEPGPTPPLSPGSSAL
GLQSTGRRGPVRCRRSRPHRRPRVQETLEPTVQAPAKRLLSVGTVGTAADLEAHVLLAKEPLIDSPAPQSPGLQHPQAPGCCCASDLQPLGPPLDPQNSMHPGPCLLSLD
NSVASFPESLPLIPYNVFETLRMFPRDAAGDHRAPMSSLEVIALDHSYASKILVPGAKARSWSTLDCDLLRLKPEGAAFLESWEEFLIKYSL*
10 >lcl|XP_003129859.2|Plus1108123..109328 NW_003535535 protein DDI1 homolog 1-like isoform 2 LOC100522388 __SEG__ Chr9 {Sus scrofa} MLLTVYCVRKDLSEATFSLQVSPDFELHNFRVLCELESGIPAEEIQIVYMERLLGDDHYSLGSYGLKDGDVVVLLQKENVGSRAPGRTSSLPQRDFPGTAVPGTSSSRHQ
HQHQHQRTQSVQQSRGMGSGEKMSSAQGLDSPALIRSMLLSNPHDLSLLKERNPALAEALLSGNLETFSQVLMEQQRERVLREQERFRLYSADPFDLEAQAKIEEEIRQQ
NIEENMNIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIIRLVDRRWAGIAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEEQPMDMLLG
LDMLRRHQCSIDLKKNVLVIGTTGTQTYFLPEGELPPCAKLVSGTGQDESSDKEVADTIKHSVMNSGRKKH*
11 >lcl|XP_003130144.1|Plus1complement(822248..825193) NW_003535566 zinc finger BED domain-containing protein 6-like LOC100523914 __SEG__ Chr9 {Sus scrofa} MSICTLSVPVSSLSPGRRCSTFSGAGILGCVPINSNTDEEDVVEGKMVAEGVDKEAKLPAKKKRKKGLRIKGKRRRKKLILAKKFSKDLGSGRPVASTTALLASDAPEHD
EESLFESNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTSTLQRHLQARHSPHWTRANKFGVTSGEEDFTLDVPLSPSSAGSNGSFEYLS
TDPLDDSGMGKKRDKSVSDALRAERGRFLIKSNIVKHALIPGTRAKTSAVWNFFYTDPQHISRAVCNICKRSVSRGRPGSHLGTSTLQRHLQATHPIHWAVANKDSGAVG
NGLDEAETEGNDLLSNTLHGEKSAGSQSVTAEDLTDSDSDEPPVLEVENRRSESPIPDAEQDTLMHAQEREATYCENSTSSQISQAIIQMIVEDMHPYNYFSTPAFQRFM
QIVAPDYRLPSETYFFTKAVPQLYDWVREKIFLTLENVQSQKIHLTVDIWTHDPSTDYFTVTVHWVSLETPSSSNSDRIPNFRKWAVLCVTGLAKDCLITNILQELNDQI
GLWLSPNFLIPSFIVSDNSSNVVHAIKDGGFTHVPCLLHCLNIVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHRLPWKNLKQDEAGHWISTFYMLKW
LLEHCYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEVTRKVSVKTTGLNQVLPLIHHLLLSLQKLREDFQVRGITQALNLVDSLSLKLETDTLLSAMLKSKPCILA
ALLDPCFKNSLEDFNPQGADLETYKQMLAEEVCNYMESSPEVCHVATSEASGPSAIVGADSFTSSIRESASSSGSIDSSAADNVAVGGKSFMFPSAMAVVDEYFKEKYSE
ISGGDDPLVYWQKKVSIWPALTQVAVQYLSCPMCSWQSECIFTANGHFHPKQIMNLDFDNIEQLMFLKMNLKNVNYDYSALVLSWDPENEVTQSSEKEILS*
12 >lcl|XP_003131137.2|Plus1complement(85033..87765) NW_003535839 DNA ligase 4-like LOC100155891 __SEG__ Chr11 {Sus scrofa} MAASQASKTVASHVPFADLCSTLERIQRSRGRGEKMRHFKEFLDSWRKFHDALHKNHRDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLL
NYRTPTGTRGDAGDFAIIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLVKKSLLQLITQSSALEQKWLIRMILKDLKLGFSQQTIFSLFHDDAAELHNVTTD
LEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIERIEKDMKHQSFYIETKLDGERMQMHKDGDVYQYFSRNGYNYGDQFGVSPQEGSLTPFIHGTFKTNVQNCILDG
EMMAYNPNTQTFMQKGNKFDIKRMVEDSDLQTCYCVFDVLMVNSKKLGHETLKNRYEILSSVFTPIPGRIEIVPKTQAHTKKEVIDALNEAIDKREEGIMIKYPLSIYKP
DKRGEGWLKIKPEYVNGLMDELDILIVGGYWGKGARGGMMSHFLCAVAEKPPAGEKPSVFHTLCRVGSGYTMKELYDLGLKLAKHWKPFHRKAPPGSILCGTEKPEVYIE
PCNSVIVQVKAAEIVPSDMYKTGCTLRFPRIEKIREDKEWHECTTLDDLEHLRGKAAGKLASKHLYVGDEEPQEKKRKAAPKAKKVIGIIEHLKAPNLSNINKVSNMFED
VEFCVMTGSDSHPKPDLESRIAEFGGYIVQNPGPDTYCVIAGSENIRVRNIISSNKHDVVKPEWLLECFRTQRCAPWQPRFMVHMCPSTKQHFARQYDCHGDSYFVDTDV
NQLKEVFSGIKTPGEQTPREMAPVIADLEHRYAWDRAPLSMFRPHTVYPDLYAVINDPSTKIEGTRLAITALELQFHGAEVVSHLAEGVSHVIIGEDHSRLADLKAFRRT
LKRKFKILPERWAIESIDKCELQEENQYWV*
13 >lcl|XP_003354829.1|Plus1954254..955033 NW_003534488 retroviral-like aspartic protease 1-like LOC100625245 __SEG__ Chr3 {Sus scrofa} MAESGARSREGHREHAFIPKPFDGANVAPHLWLYRFEVINDLNHWDHVNKLRFLKESLRGEALEVYSGLSPEDQGNYRAVKETLLKTFGGPEATPTHLPKEIVFANSMGK
GYYLKGKIGKVPVRFLVDSGAQVSVVHPSLWEEVTDGDLDTLRPFENVVKVANGAEMKILGVWDTVVSLGKLKLKASFLVANASAEEAIIGTDVLQDHNAILDFEHRTCT
LKGKKFRLLPVGGSLEDEFDLELIEEEPSSEEGRQQLSC*
14 >lcl|XP_003357428.1|Plus1complement(923340..926285) NW_003535566 zinc finger BED domain-containing protein 6-like LOC100622313 __SEG__ Chr9 {Sus scrofa} MSICTLSVPVSSLSPGRRCSTFSGAGILGCVPINSNTDEEDVVEGKMVAEGVDKEAKLPAKKKRKKGLRIKGKRRRKKLILAKKFSKDLGSGRPVASTTALLASDAPEHD
EESLFESNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTSTLQRHLQARHSPHWTRANKFGVTSGEEDFTLDVPLSPSSAGSNGSFEYLS
TDPLDDSGMGKKRDKSVSDALRAERGRFLIKSNIVKHALIPGTRAKTSAVWNFFYTDPQHISRAVCNICKRSVSRGRPGSHLGTSTLQRHLQATHPIHWAVANKDSGAVG
NGLDEAETEGNDLLSNTLHGEKSAGSQSVTAEDLTDSDSDEPPVLEVENRRSESPIPDAEQDTLMHAQEREATYCENSTSSQISQAIIQMIVEDMHPYNYFSTPAFQRFM
QIVAPDYRLPSETYFFTKAVPQLYDWVREKIFLTLENVQSQKIHLTVDIWTHDPSTDYFTVTVHWVSLETPSSSNSDRIPNFRKWAVLCVTGLAKDCLITNILQELNDQI
GLWLSPNFLIPSFIVSDNSSNVVHAIKDGGFTHVPCLLHCLNIVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHRLPWKNLKQDEAGHWISTFYMLKW
LLEHCYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEVTRKVSVKTTGLNQVLPLIHHLLLSLQKLREDFQVRGITQALNLVDSLSLKLETDTLLSAMLKSKPCILA
ALLDPCFKNSLEDFNPQGADLETYKQMLAEEVCNYMESSPEVCHVATSEASGPSAIVGADSFTSSIRESTSSSGSIDSSAADNVAVGGKSFMFPSAMAVVDEYFKEKYSE
ISGGDDPLVYWQKKVSIWPALTQVAVQYLSCPMCSWQSECIFTANGHFHPKQIMNLDFDNIEQLMFLKMNLKNVNYDYSALVLSWDPENEVTQSSEKEILS*
15 >lcl|XP_003358472.1|Plus1180568..181512 NW_001885312 three prime repair exonuclease 1-like LOC100627346 __SEG__ Chr13 {Sus scrofa} MGSQALPQAPVQTLIFLDLEATGLPFSQPKVTELCLLAVHRCALESLPIPQGPSPTVPPPPRVLDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQYFDANLANLLRA
FLQRQPQPSCLVAHNGDRYDFPLLQAELAMLGLASALDDTFCVDSIAALKALEQADGSSEHGPRKSYSLGSIYTRLYGQAPPDSHTAEGDVLALLSICQWRPRALLRWVD
VHARPFSTVKPMYVVTASTGTNPRPSAAKATVLLAKARNTSPNLGGDRSPKPLSPMKSPGTPPREGLLAPLGLLAFLTLAVATLYGLSIAIPGH*
16 >lcl|XP_003360533.1|Plus1complement(722735..723445) NW_001886700 three prime repair exonuclease 2-like LOC100621378 __SEG__ ChrX {Sus scrofa} MAEAPRAETFVFLDLEATGLPSVDPEIAEISLFAVHRSSLENPERDESGAPVLPRVLDKLTLCMSPEHPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQEG
PVCLVAHNGFDYDFPLLRTELWRLGAHLPQDTVCLDTLPALRSLDRAHSHGTRAQGRKGYSLGSLFRRYFQAEPSAAHSAEGDVHTLLLVFLHRAAELLTWADEQALSWA
QVEPMYVPHDGPGLEA*