SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor L    

ID / Description / Sequence
1 >lcl|NP_001012075.1|Plus1768294..769517 NW_047602 TSPY-like 4 Tspyl4 __SEG__ Chr20 {Rattus norvegicus} MNGVEGNNELPLANTSTSALVPEDLDLKQDQPLSEETDTVREMEAAGEAGAEGGASPDSEHCDPQLCLRVAENGCAAAAGEGLEDGLSSSKCGDAPLASVAANDSNKNGC
QLAGPLSPAKPKTLEASGAVGLGSQMMPGPKKTKVMTTKGAISATTGKEGEAGAAMQEKKGVQKEKKAAGGGKDETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQ
LERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMMRYMINLEVEELKHPRAGCKFKFIFQSNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQE
PQAHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKGELWSNPLQYYLMGDGPRRGVRVPPRQPVESPRSFRFQSG*
2 >lcl|NP_001012522.1|Plus118232968..18233837 NW_047536 protein SET Set __SEG__ Chr19 {Rattus norvegicus} MAPKRQSAILPQPKKPRPVAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELITKIPNFWVTTFVNHPQVSALLGE
EDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKCSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVI
KDDIWPNPLQYYLVPDMDDEEGEAEDDDDDDEEEEGLEDIDEEGDEDEGEEDNDEDEGEEGEEDEGEDD*
3 >lcl|NP_001013051.1|Plus1751275..752414 NW_047602 TSPY-like 1 Tspyl1 __SEG__ Chr20 {Rattus norvegicus} MSVREPDEGTPVPDHRGLCDADTIPGTPGWRPLLGEKAVTGEGSAGIVGSPAPRGVAGLGPQVRVAAARQGETPPVVEGPAAAAFVAPKDAEKALETRGAEARAHDVKIE
RATVAVAAREQSEVAMQGSEEVMEVEQKPAGEEMEMPEASGGAREAQEEAGPWHLGIDLRTNPLEAIQLELDTVNAQADRAFQHLEQKFGRMRRHYLERRNYIIQNIPGF
WMTAFRNHPQLSAMIRGQDAEMLRYITNLEVKELRHPKTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVSLSTPIIWRSGHEPQSFIRRNRDLICSFFTWFSDHSVPE
SDRIAEIIKEDLWPNPLQYYLSREGIRRPRRRPIREPVEIPRPFGFQSG*
4 >lcl|NP_001020160.1|Plus1complement(515239..516189) NW_047802 three prime repair exonuclease 1 Trex1 __SEG__ Chr8 {Rattus norvegicus} MGSQALPHGHMQTLIFLDLEATGLPYSQPKITELCLLAVHRHALENSSMSEGQPPPVPKPPRVVDKLSLCIAPGKPCSSGASEITGLTTAGLEAHGRQRFNDNLATLLQV
FLQRQPQPCCLVAHNGDRYDFPLLQAELASLSVISPLDGTFCVDSIAALKTLEQASSPSEHGPRKSYSLGSIYTRLYGQAPTDSHTAEGDVLALLSICQWKPQALLQWVD
KHARPFSTIKPMYGMAATTGTASPRLCAATTSSPLATANLSPSNGRSRGKRPTSPPPENVPEAPSREGLLAPLGLLTFLTLAIAVLYGIFLASPGQ*
5 >lcl|NP_001073180.1|Plus1complement(7906729..7908261) NW_047798 similar to jumonji domain containing 2D LOC689582 __SEG__ Chr8 {Rattus norvegicus} MKTKSTCAQNPNCSIMIFRPTKEEFNDFDKYIAYMESQGAHRAGLAKVIPPKEWRARQSYDNISNILIATPLQQVVSGQAGVFTQYHKKKKAMTVGQYRHLANSKKYQTP
PHLDFEDLERKYWKNRLYESPIYGADVSGSLFDGKTQQWNVGHLGTIQDLLEQECGIVIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGQPKTWYAVPPEHGRRL
ELLAKELFPGSSQGCQAFLRHKVALISPTVLKENGIPFGRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYGKVASQCSCGEARVSFSMDAFVRILQPERY
EMWKRGQDQAVVDHTEAMGPTSQELTTWRVIQAPRKTWGLKHLRLRQVSRCLLPVATDSNIANNTQMCHTSRQAADSKGDEVQESDPAIAPPYPLGLSSPGHMSTGKRGL
GRRPCELGVQESTNGAPVKRRLPEGRDDRSPSPELQSQSVTGDLIVNSDLVNPGPQHPVTASEGGLTSDP*
6 >lcl|NP_001078944.1|Plus1complement(3238389..3239615) NW_047797 protein DDI1 homolog 1 Ddi1 __SEG__ Chr8 {Rattus norvegicus} MLITVYCVRRDLTEVTFSLQVNPDFELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCSLGSYGLKDGDMVVLLQKDNVGPRPPGRAPNHPRTDFTGSGSAVPGTSSSR
HPHPHQHHHHQHQRIPSTQQAHGLASGENMAFAQDLNSPALIRSMLLSNPHDLSLLKERNPALAEALLSGNLETFSQVLVEQQRERAMREQEMFRLYSADPFDQETQARI
EEEIRQQNIEENMNIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIMGRVHLAQIQIEGDFLQCSFSILEEQ
PMDILLGLDMLRRHQCSIDLKKNVLVIGTTGSQTHFLPEGELPLCAKLLSGAVQEDSSDKEVAGSIKHPVKGPGRKKH*
7 >lcl|NP_001099565.1|Plus12724314..2727049 NW_047477 DNA ligase (ATP) 4 Lig4 __SEG__ Chr16 {Rattus norvegicus} MASSQASRTVAAHVPFADLCSTLERIQKGKDRAEKIRHFKEFLDSWRKFHDALHKNKKDVPDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPREGKDAQKLL
NYRTPSGARSDAGDFATIAYFVLKPRCLQKGSLTIQKVNELLDLVASNNSGKRKDLVKKSLLQLITQCSALEQKWLIRMIIKDLKLGVSQHTILSIFHNDAVELHNVTTD
LEKVCRQLHDPSVGLSDISITLFSAFRPMLAAVADVERVEKDMKQQSFYIETKLDGERMQMHKDGALYRYFSRNGYNYTDQFGESPQEGSLTPFIHNAFKTDVQVCILDG
EMMAYNPTTQTFMQKGVKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGRETLRKRYDILSSTFTPIQGRIEIVQKTQAQTKQEVVDALNDAIDKREEGIMVKHPLSIYKP
DKRGEGWLKIKPEYVTGLMDELDLLIVGGYWGKGSRGGMMSHFLCAVAETPPPGDKPSVFHTLCRVGSGYTMKELYDLGLKLAKYWKPFQRKSPPSCILCGTEKPEVYIE
PQNSVIVQIKAAEIVPSDMYKTGSTLRFPRIEKIRDDKEWHDCMTLDDLEQLRGKASGKLATKHLHIGDDDEPREKRRKPISKTKKTIGIIEHLKAPNLSNINKVSNVFE
DVEFCVMSGLDGYPKPDLENKIAEFGGYIVQNPGPDTYCVIAGSENIRVRNIISSDRHDVVKPEWLLECFKTKTCVPWQPRFMIHMCPSTKQHFAREYDCYGDSYFVDAD
LDQLKEVFLRIKPSEQQTPEEMAPVIADLECRYSWDHSPLSMFRHYTVYLDLYAVINDLSSKIEATRLGVTALELRFRGAKVVSRLSEGVSHVIIGEDQRRVSDFKTFRR
TLKKKFKILQERWVIDSVDKCELQEENLYLL*
8 >lcl|NP_001099997.1|Plus1complement(33752551..33753555) NW_047658 TSPY-like 3 Tspyl3 __SEG__ Chr3 {Rattus norvegicus} MAGEGIGALELAMCLPPIQERDALLARNSVPGAGTLRPCDPAASPGTAPLSPENTGENPASSVLKLGGCEKGSGTGVGTKGKAEEVTTKEDCVAAEEPAQVGEKLEWIAE
AQASLRPLDLGALIVDPLEAIQWEFEVMSAQSDGAHLQLVRRFERMRRLHLARRSFIIQNIPGFWVTAFLNHPQLSAMISPRDEDMLGYLMNLEVRELRHTRTGCKFKFL
FGSNPYFRNEVIVKEYECRSSGRVVAIATRIRWHRGQEPPALVHRNRDTMRSFFSWFSQHSLLEADRVAQILKDDLWPNPLQYYLLGQRPYRARPNLARCPAEAPPRPYG
FQSG*
9 >lcl|NP_001102843.1|Plus1complement(379842..380486) NW_047537 high mobility group box 1 like Hmg1l1 __SEG__ Chr19 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIPAYRAKGKPDAAKKGVVKAEKSKKKKEEEDNEEDEEDEEEEEEEEDEDEEDDDDE*
10 >lcl|NP_001128318.1|Plus114295085..14295915 NW_047491 HUS1 checkpoint homolog b Hus1b __SEG__ Chr17 {Rattus norvegicus} MKFRARITSKRFIELFIQVNSTIAKLTKVCVLRVCPDRLCFCPMGLLSEAKLWGEVRRNVFPHFCMEGVSQEFNEIYLELTSEHLARAVRNASNASSLKLQLTNKLRPCL
TVVVELASCPGHTRAMVHDLPVRVLPRRWWKECTEPHVRGSDVSVYLPAMKTLKNMVERMANVGSHVLVEANLKGKMNLSVETDGVTIKSYFRNLGSPPNAVLGMSQGKD
PDNMVQVRVDNRKLLRFFDGQQINPTMALCNILSNTLLHLVLVHEDISLQYFIPAS*
11 >lcl|NP_445882.1|Plus1complement(21216134..21217276) NW_047563 flap structure-specific endonuclease Fen1 __SEG__ Chr1 {Rattus norvegicus} MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYIFDGKPPQLKSGELAKRSERRAEAEKQ
LQQAQEAGAEEEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALAKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRVLQELGLNQ
EQFVDLCILLGSDYCESVRGIGPKRAVDLIQKHKSIEEIVRRLDPSKYPVPENWLHKEARQLFLEPEVLDPESVELKWSEPNEEELVKFMCGEKQFSEERIRSGVKRLNK
SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGPAKKKAKTGGAGKFRRGK*
12 >lcl|NP_919334.1|Plus1complement(53037584..53038441) NW_047454 SET translocation Setl1 __SEG__ Chr15 {Rattus norvegicus} MAPKRQSAIPPQPKKPRPIAAPKLEDKLASPSLPKGEKEQQETIDHIDEVQNEMDRLNEQASEEILKVEQKYNRLCQPFFFSEEVRIDRQNPKFLGNNICQPSTSVCTAW
GGRRGGPALFDQS*SDRIWRH*IRLQNRFLF**KSLL*K*SSLQRISSE*ER*PVFKVHRNQMEIWEGFDKMLKSNAE*GQQEEAA*KARELLSLVY*PF*RRC*RVRRG
RQG*YLAKPLAVLFGSRYG**RRGRG****RRRRRTVGRY**RRQG*R*RR*R*GGRGGRKTKARM
13 >lcl|XP_001064282.1|Plus1complement(1461346..1461852) NW_048049 high-mobility group box 4-like LOC685552 __SEG__ ChrX {Rattus norvegicus} MGKDSKVRPKVNVSPYVHFMMDFRNQMREQQPNIYYDFTEFSRKCSEKWKTISKKEKKKYEALAKRDKDRYQREMRNYSGPRRERRRRDPDAPRKPPSSFLLFSQDHFEE
IKEQHPNWTVAQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEEREAYYQQCQRGK*
14 >lcl|XP_001068941.1|Plus1complement(42260411..42261055) NW_047625 high mobility group box 1 LOC689398 __SEG__ Chr2 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEVSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTASDDKQPYEKKAAKLKEKYEKDTAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDE*
15 >lcl|XP_001074673.1|Plus134939912..34940553 NW_047658 high mobility group box 1 LOC690521 __SEG__ Chr3 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKAMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFLFCSEYRP
KIKGEHPALSIGDVTKKLGEVWTNTASDDKQPCEKMAAKLKEKYEKDTAAYRAKGKPDAAKKGVVKAERSKKKKEEEDDEEDEDDEEEEEEEDEDDEEDDDDE*
16 >lcl|XP_001076232.1|Plus1complement(68369..69013) NW_047674 high mobility group box 1 LOC690940 __SEG__ Chr3 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEVSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTASDDKQPYEKKAAKLKEKYEKDTAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDE*
17 >lcl|XP_001076590.1|Plus1631982..632488 NW_048032 high-mobility group box 4-like LOC691030 __SEG__ ChrX {Rattus norvegicus} MGKDSKVRPKVNVSPYVHFMMDFRNQMREQQPNIYYDFTEFSRKCSEKWKTISKKEKKKYEALAKRDKDRYQREMRNYSGPRRERRRRDADAPRKPPSSFLLFSQDHFDE
IKEQHPNWTVGQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEEREAYHQQCQRGK*
18 >lcl|XP_001076648.2|Plus1<1113849..1114367 NW_048032 high-mobility group box 4-like LOC691047 __SEG__ ChrX {Rattus norvegicus} HGKEVHSRPKVNVSSYIHFMLNFRDQVKEQQPNTYHHFASFSRKLSEKWRSISKPENVENEALDKLNKGQYKDKMRNYRRKRRKRRRDANTLHKPPSSFLMFSLDHFTQL
KKENTKWTVVEVAKPARMIWSMSTNVNKISFEQKAVLLQPKYLEKWEAYCHQCQGKKSNFFG*
19 >lcl|XP_002730232.1|Plus1complement(4535716..4536957) NW_048034 rCG64297-like LOC100362219 __SEG__ ChrX {Rattus norvegicus} MIEASNSSGSYRSNVKTSTSRFIQDASFSPSLPAISQSLSCKNKNDSLQPNSYFSPWNDHSCTSSTKISQYCPSNSSSTTKSTSTDERVKKDIPVGYSYYTVTSEEMTGH
MQGTETQAKNTNQEDAGGFASDFLPRHHSHPSQMEGFIDTHCHLDMLFSKLSFQGSFAEFREMYSYTFPKEFQGCISDFCDPRTLRNGLWKELLNEDLVWGAFGCHPHFA
RYYNEHQERNILYALRHPKAVAFGEMGLDYSYKCTTPVPDQFRVFERQLQLAVSMKKPLVIHCREADEDLMGIMKKHVPYDYKIHRHCFTGSYPLIEPLLEYFPNMSVGF
TAVLTYSSAWQARDALKKIPLERILIETDAPYFLPRHVPKSLCQYAHPGMGLHTVQEIANIKNEPLSHVLATLRENTSHLYNI*
20 >lcl|XP_218493.2|Plus1complement(2481500..2482321) NW_047557 SET translocation-like RGD1563307 __SEG__ Chr1 {Rattus norvegicus} MSAPTAKASKKELNSNHDGADKTSEKEQQEAIEHIGKVQNEIDRLNEQASEEVLKVEQKCNKLRQPFFQKRSELIAKVPKFWVTTFINHPQVSAFLAEEDEEALHYLTRV
EVREFEDIKSGYGIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQIKARRKRQHEEPESFFTWFTDHSDADADDLGEAIKDDIWPNPLQYY
LFPNMDNEEGEADDDDDYDEEEGLEDTDEGDEDEDDDDEEEGEEGEEGKGGDN*
21 >lcl|XP_227148.4|Plus1complement(30215691..30217550) NW_047625 rCG49985-like RGD1564472 __SEG__ Chr2 {Rattus norvegicus} MSLKTAQSWFPQGHPEARRVLVHPVGNFLLSYYQCPPTCCQTHQFIVVQVPSPRPGPGAHHGWLAAPWEQLHWRPQVVWRKILCPETLTTSSSTASSSSSSSSSAASSSS
SSSAMSSSSSSSSSSLSSSASAREKRRLIHTSSPSLANTTAAKRTFSSSIATGQPPHLNTYIVTPQQVIYSYTLIGVKKPVLTKEFKDKIPVAMRQHYLGLFTEECLKFS
SSHLEAIEKAQSEEKVIYDRSPSKNKYLNVALHTLKKLRGLVPSAIPGLSKATLYSRLQGYLLTEEQRKVHGFPFAHPEKPGSAMLYTREQPLSTAHRTCCRCGNKFLVS
SSGRCLSSEPCVYHWGRVLSNPVQGGWQVRYSCCSAPMGATGCKVAKQHVQDGRKDNLHGFAKTFPKKDWEAHAGIYALDCEMSYTTHGLELTRVTVVDTDQHVIYDTFV
KPDNEIVDYNTMFSGVTETDLANTRVRLCDVQAVLLSLFSTETILIGHSLESDLLALKFIHGTVVDTSVLFPHHRGPPFKRSLRGLTSQYLNRIIQTDSGGHSSIEDATA
CMQLVTWKIQEDAKTSSPSQQQASSQKCDPLPKLRVCTSRYTQTPKMLEIPDVLYLEESDSDQSPQLET*
22 >lcl|XP_234776.5|Plus1complement(1360589..1361821) NW_047778 TSPY-like 5 Tspyl5 __SEG__ Chr7 {Rattus norvegicus} MSGRSRGRRSSRAKGRGKGRARARVPAAADDIWRDEKPAQSPRLGEDAAAAQVQDGTAHGGTEPAEPGEAEACRLPLDCGLALRARAAGECGLAAPDPGLERATALAERL
TSDISFVGTVGALAKLRQGSRIGNRRVPGRKAPGPRSATGRGPQATVSGKPKMGSARPCAAAPVGEEKKVTEKHAGSGSPAAVGSMDTLETVQLKLETMNAQADRAYLRL
SRKFGQLRLHHLERRNLLIQSIPGFWGQAFQNHPQLSSFLNTKDKEVLSYLNRLEVEELGLARLGYKIKFYFGRNPYFQNKVLIKEYGCGPSGQVVSRSAPIQWLPGHDL
QSLSKENPENNGSFFGWFSNHSSIESDKIVEIINEDLWPNPLQYYLISEEAHGEKGKEERPPGPAKQPVESPKPAVRQPN*
23 >lcl|XP_573272.3|Plus11671700..1672332 NW_047356 high mobility group protein B2-like RGD1564519 __SEG__ Chr11 {Rattus norvegicus} MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHR
PKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEVGKKGPGRPTGSKKKNEPEDEEEEEEEEDDEDEEEEDEDEE*
24 >lcl|XP_573625.1|Plus11786664..1787293 NW_047428 high mobility group protein B2-like RGD1561694 __SEG__ Chr14 {Rattus norvegicus} MGKGDPNKPRGKMSLYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGNKKGKKKDPNAPKRPPSAFFLFCSEHR
PKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEVGKKGPGRPTGSKKKNEPEDEEEEEEEDGEDEEEEDEDEE*
25 >lcl|XP_574433.1|Plus1complement(2615764..2616870) NW_047558 interferon-stimulated 20 kDa exonuclease-like 2-like RGD1565346 __SEG__ Chr1 {Rattus norvegicus} MSTILLNLDFGEPSKKAFGGNAKHQRFVKKRRFLEQKGFLSKKNQPPSKVSKLNSEPPKKGETSRVDSISKILSCLKKKKEAAASKRDSEQSKDKKASSWLTPAPSKKTD
SVVAKIDLLGEFQSALPKPKRRTQKKGSKKPLKKKIATENSTQAQSKDKGSNKKPLKKNAVQNSTQAQPEDKCPKVPQSLPRKMVAIDCEMVGTGPKGRVSSLARCSIVN
YNGDVLYDEYIRPPCYIVDYRTRWSGIRKCHMVNATPFKTARSQILKILSGKVVVGHAIHNDYKALQYFHPKSLTRDTSQIPLLNRKADCPENVTLSLKRLTKKLLSRDI
QTGLSGHSSVEDAQATLELYKLVEVEWEQHLAQNPPEN*
26 >lcl|XP_576355.1|Plus1complement(7895295..7896677) NW_047798 rCG31764-like RGD1563367 __SEG__ Chr8 {Rattus norvegicus} MTNLEQDVSQNPGCSIMTFCPTMEEFSDFCKYIAYMESQGAHRAGVAKVIPPKDWKRRQSYEDVMDMSIPAPLQQVVSGKAGVFTQYHKKKKAMTVGKYRELAESKQYQT
PPHLDFEDLERKYWKNRLFGSPIYGADVSGSLFDENTQHWNVGHLGSLLDVLKQDRGIVIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGQPKTWYAVPPEHGRR
LELLAKELFPGSSQGCQAFLRHKVALISPTVLKENGIPFGRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYGKVASQCSCGEARVSFSMDAFEGLLQPEP
YEMWKQQGNQRAMDPLALTSGPRQELTLGIDQLKPDSKQNGSHSGPRRNWLRRGQKSCPYRKVHAESPCPPTGKLLAPRSVPQGTRCSKQASGSSKTPAICADVLAVNHS
QACRILDRSLIVSLPLQDLN*