SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus L    

ID / Description / Sequence
1 >lcl|NP_001008551.1|Plus1complement(168477..169346) NT_165754 hypothetical protein LOC434632 BC085271 __SEG__ Chr1 {Mus musculus} MAPKRQSVILPQPKKPRPAAAPKLEDKLASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVHHPQVSALLGE
EDEEALHYLTRVEVTEFEDIKSGNRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKHSSQTQNKASRKRQHEEPESFFSWFTDHSDAGANELGEVI
KDDIWPNPMQYYLVPDMDDEEGEAEDDDDEDKEEEGLEDIDEEGDEDEGEEDDDEEEGEEGEEDEGEDD*
2 >lcl|NP_001078890.1|Plus1complement(24631804..24633024) NT_039618 testis-specific Y-encoded-like protein 5 Tspyl5 __SEG__ Chr15 {Mus musculus} MSGRSRGRKSSRAKGRGKGRARARVRAAAEDAWHDEKPPQSPRLGEDSAAAQVQAGAAQGGAEPAELREEAACRLPLDCGLALRARAADERGLAAPDPDLERARSLAERL
TSDTSFVGTVGALAKLRRGSRIGNRRVPGRKAPDTRSATGRGPQATVSGKPKMASAGLCAAAPVGEEKKMTEKHAGAGSPATVGSMDTLETVQLKLETMNAQADRAYLRL
SRKFGQLRLHHLERRNLLIQSIPGFWGQAFQNHPQLSAFLNTKDKEVLSYLNRLEVEELGLARLGYKIKFYFGRNPYFQNKVLIKEYGCGPSGQVVSRSAPIQWLPGHDL
QSLSKENPENNGSFFGWFSNHSSIESDKIVEIINEDLWPNPLQYYLISEEARGEKGKEERPGPAKLSPAPAVRQPN*
3 >lcl|NP_001160024.1|Plus1complement(48209554..48212496) NT_078297 zinc finger BED domain-containing protein 6 Zbed6 __SEG__ Chr1 {Mus musculus} MSVCTLSVPVSSISPGRRCSTFGDAGILGCVSINSNTDEDDVVEGKMVAEGANKETKLPAKKKRKKGLRIKGKRRRKKLILAKKFSKDLGSGRPVADAPASLASGAPEQD
EESLFEGNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTSTLQRHLQARHSPHWTRANKFGVTNGEEDFTLDLSLSPPSPGSNGSFEYIP
TDSVDENRMGKKRDKSASDALRAKRGRFLIKSNIVKHALIPGTRAKTSAVWNFFYTDPQHISRAVCNICKRSVSRGRPGSHLGTSTLQRHLQATHPIHWAVANKDSGAIG
NGLDETETESSDLLNDTMPGEKSSGSQDLTAEDLSDSDTDEPPCLEVENRSESPIPVADQDNPVHAQERETTTHCENAAANQISQAVIQMIVEDLHPYNYFSTPAFQRFL
QIVAPDYRLPSETYFFTKAVPQLYDSVREKIFLTLENVQSQKIHLTADIWTHDPSTDYFIVTVHWVSLETASSPSNGGTPNFRKWAVLCVTGLAKDCLITNILQELNDQI
GLWLSPNFLTPSFIVSDNSSNVVHAIKGGGFTHVPCFLHCLNIVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHQLPWKNLKQDETGHWISTFYMLKW
LLEHCYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQRVSVKTTGLNQVLPLIHHLLFSLQRLREDFQVRGITQALNLVDSLSLKLESDALLSAMLKSKHCILA
TLLDPCFKNSLEDFFPQGADLETYKQILAEEVCNYMESSPGACQISSSETSGPLVRLGTDSFTSIKEGTSSAGSLDSSAAGSVAVGSKSSLLPAAVAVVDEYFKEKYSEL
SGGDDPLVYWQRKVSIWPALTQVAIQYLSCPMCSWQSECMFTTNSHFHPKQIMNMDFDNIEQLIFLKMNLENVNYDYSTLILSWDPENKAVQSNEKEILP*
4 >lcl|NP_032025.2|Plus1complement(3386321..3387463) NT_039687 flap endonuclease 1 Fen1 __SEG__ Chr19 {Mus musculus} MGIHGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQ
LQQAQEAGMEEEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALAKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRVLQELGLNQ
EQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPSKYPVPENWLHKEAQQLFLEPEVLDPESVELKWSEPNEEELVKFMCGEKQFSEERIRSGVKRLSK
SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGPAKKKAKTGGAGKFRRGK*
5 >lcl|NP_033459.1|Plus126705545..26706684 NT_039492 testis-specific Y-encoded-like protein 1 Tspyl1 __SEG__ Chr10 {Mus musculus} MSSPERDEGTPVPDSRGHCDADTVSGTPDRRPLLGEEKAVTGEGRAGIVGSPAPRDVEGLVPQIRVAAARQGESPPSVRGPAAAVFVTPKYVEKAQETRGAESQARDVKT
EPGTVAAAAEKSEVATPGSEEVMEVEQKPAGEEMEMLEASGGVREAPEEAGPWHLGIDLRRNPLEAIQLELDTVNAQADRAFQHLEQKFGRMRRHYLERRNYIIQNIPGF
WMTAFRNHPQLSAMIRGRDAEMLRYVTSLEVKELRHPKTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVSLSTPIIWRRGHEPQSFIRRNQDLICSFFTWFSDHSLPE
SDRIAEIIKEDLWPNPLQYYLCREGIRRPRRRPIREPVEIPRPFGFQSG*
6 >lcl|NP_035767.4|Plus1complement(146017..146961) NT_039482 three prime repair exonuclease 1 Trex1 __SEG__ Chr9 {Mus musculus} MGSQTLPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENTSISQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRA
FLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASSPSGNGSRKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVD
EHARPFSTVKPMYGTPATTGTTNLRPHAATATTPLATANGSPSNGRSRRPKSPPPEKVPEAPSQEGLLAPLSLLTLLTLAIATLYGLFLASPGQ*
7 >lcl|NP_036037.1|Plus1complement(18263375..18264085) NT_039706 three prime repair exonuclease 2 Trex2 __SEG__ ChrX {Mus musculus} MSEPPRAETFVFLDLEATGLPNMDPEIAEISLFAVHRSSLENPERDDSGSLVLPRVLDKLTLCMCPERPFTAKASEITGLSSESLMHCGKAGFNGAVVRTLQGFLSRQEG
PICLVAHNGFDYDFPLLCTELQRLGAHLPQDTVCLDTLPALRGLDRAHSHGTRAQGRKSYSLASLFHRYFQAEPSAAHSAEGDVHTLLLIFLHRAPELLAWADEQARSWA
HIEPMYVPPDGPSLEA*
8 >lcl|NP_080690.2|Plus138891130..38892149 NT_039353 retroviral-like aspartic protease 1 precursor Asprv1 __SEG__ Chr6 {Mus musculus} MRNPGGPGWASKRPLQKKQNTACLCAQQPARHFVPAPFNSSRQGKNTAQPTEPSLSSVIAPTLFCAFLYLACVTAELPEVSRRMATSGVRSKEGRREHAFVPEPFTGTNL
APSLWLHRFEVIDDLNHWDHATKLRFLKESLKGDALDVYNGLSSQAQGDFSFVKQALLRAFGAPGEAFSEPEEILFANSMGKGYYLKGKVGHVPVRFLVDSGAQVSVVHP
ALWEEVTDGDLDTLRPFNNVVKVANGAEMKILGVWDTEISLGKTKLKAEFLVANASAEEAIIGTDVLQDHNAVLDFEHRTCTLKGKKFRLLPVGSSLEDEFDLELIEEEE
GSSAPEGSH*
9 >lcl|NP_082218.1|Plus1complement(3265141..3266367) NT_039471 protein DDI1 homolog 1 Ddi1 __SEG__ Chr9 {Mus musculus} MLITVYCVRRDLTEVTFSLQVNPDFELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCSLGSYGLKDGDMVVLLQKDNVGLRTPGRTPNHPRADFTGSGSAVPGTSSSR
HPHQHQHHYHHHQRIPSTQQAHGLASGENMTFAQELDSPALIRSMLLSNPHDLSLLKERNPALAEALLSGNLETFSQVLMEQQRERTLREQEMFRLYSTNPFDQETQARI
EEEIRQQNIEENMNIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWGGVAKGVGTQRIMGRVHLAQIQIEGDFLQCSFSILEEQ
PMDILLGLDMLRRHQCSIDLKKNVLVIGTTGSQTHFLPEGELPLCAKLLSGTVQEESSDREVGGTIKHPVKGPGRKKH*
10 >lcl|NP_084479.1|Plus126720778..26721998 NT_039492 testis-specific Y-encoded-like protein 4 Tspyl4 __SEG__ Chr10 {Mus musculus} MNGVEGNNELSLANTTTPSHASEDLDLKQDQGLQEETDTVREMEAAGEAGADGGASPDSEHCGPELCFRVAENSCAAAARGLEDAPSPSKGGDAPSAPVAADDSSKNGCQ
LEGPHSPAKPKALEACGAVGLGSQQMPGPKKTKEMTTTKCAISVATGKEGEAGAAMQEKKGLQKEKKVAGGGKEETRPRAPKINCMDSLEAIDQELSNVNAQADRAFLQL
ERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMMRYMINLEVEELKQPRVGCKFKFIFQSNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQEP
QAHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKGELWSNPLQYYLMGDGPRRGVRVPPRQPVESPRSFRFQSG*
11 >lcl|NP_694712.1|Plus1complement(19865372..19866202) NT_039578 checkpoint protein HUS1B Hus1b __SEG__ Chr13 {Mus musculus} MRFRARITSKRFIELFIQVSSTVAKLAKVCVLRVCPDRLYFCPMGLLGEAQLWGEMRRDVFHHFCMEGASQEFNEICLELMSEHLARAVKNAGNASSLKLQLTNKQRPCL
TLVVELASCPGHTRAVVHDLPVRVLPRRRWKDCTEPHVRGSDVSVYLPALKTLKNMVERMANVGSHVLVEANLNGRMNLTVETDRVTIKSYFKNLGNPPNAVLCMSQGRD
PETMVQVRVDNRKLLQCFDGHQINPTMALCNILSNTLLHLVLVHEDISLQYFIPAS*
12 >lcl|NP_775609.2|Plus1complement(1049949..1051481) NT_039472 lysine-specific demethylase 4D Kdm4d __SEG__ Chr9 {Mus musculus} MKTKSTCAQNPNCSIMIFRPTKEEFNDFDKYIAYMESQGAHRAGLAKVIPPKEWRARQSYDNISNILIATPLQQVVSGQAGVFTQYHKKKKGMTVGEYRELANSKKYQTP
PHLDFEDLERKYWKNRLYESPIYGADVSGSLFDGKTQQWNVGHLGTIQDLLEQECGIVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGQPKTWYAVPPEHGRRL
ERLARELFPGSSQGCQAFLRHKVALISPTVLKENGIPFGRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYGKVASQCSCGEARVSFSMDAFVRILQPERY
ELWKRGQDQAVVDHTETMVSTSQELTTRRVTKAPRKTWGLKRLRLRQVSRSLLPIATVSNVPCNMQVCHTSRQPSDVKGDDVQKSDSARASPHPLSLPSSGHMSTRRCSL
GRRPCELGAQESSNGAPVKRQLPAGRDDTSPSPELQPQAVSGDLIVDSGLVNPGPQHLMTASEGGLTSDP*
13 >lcl|NP_795927.2|Plus1complement(6971043..6973778) NT_039455 DNA ligase 4 Lig4 __SEG__ Chr8 {Mus musculus} MASSQTSQTVAAHVPFADLCSTLERIQKGKDRAEKIRHFKEFLDSWRKFHDALHKNRKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPREGKDAQKLL
NYRTPSGARTDAGDFAMIAYFVLKPRCLQKGSLTIQQVNELLDLVASNNSGKKKDLVKKSLLQLITQSSALEQKWLIRMIIKDLKLGISQQTIFSIFHNDAVELHNVTTD
LEKVCRQLHDPSVGLSDISITLFSAFKPMLAAVADVERVEKDMKQQSFYIETKLDGERMQMHKDGALYRYFSRNGYNYTDQFGESPQEGSLTPFIHNAFGTDVQACILDG
EMMAYNPTTQTFMQKGVKFDIKRMVEDSGLQTCYSVFDVLMVNKKKLGRETLRKRYEILSSTFTPIQGRIEIVQKTQAHTKKEVVDALNDAIDKREEGIMVKHPLSIYKP
DKRGEGWLKIKPEYVSGLMDELDVLIVGGYWGKGSRGGMMSHFLCAVAETPPPGDRPSVFHTLCRVGSGYTMKELYDLGLKLAKYWKPFHKKSPPSSILCGTEKPEVYIE
PQNSVIVQIKAAEIVPSDMYKTGSTLRFPRIEKIRDDKEWHECMTLGDLEQLRGKASGKLATKHLHVGDDDEPREKRRKPISKTKKAIRIIEHLKAPNLSNVNKVSNVFE
DVEFCVMSGLDGYPKADLENRIAEFGGYIVQNPGPDTYCVIAGSENVRVKNIISSDKNDVVKPEWLLECFKTKTCVPWQPRFMIHMCPSTKQHFAREYDCYGDSYFVDTD
LDQLKEVFLGIKPSEQQTPEEMAPVIADLECRYSWDHSPLSMFRHYTIYLDLYAVINDLSSRIEATRLGITALELRFHGAKVVSCLSEGVSHVIIGEDQRRVTDFKIFRR
MLKKKFKILQESWVSDSVDKGELQEENQYLL*
14 >lcl|NP_852077.1|Plus149896165..49899671 NT_039621 zinc finger BED domain-containing protein 4 Zbed4 __SEG__ Chr15 {Mus musculus} MEDKQETCPKGDSDFVSDKVNFKTEEDDDQTPCHSLEQVDFKSESEDMRQTDSGDEQADIRAASCACQPSGKFLAAESEDDYGSLFSQYSSTLYSVAMEAVTQSLLSSRH
ISSRKKSPAWKHFFISPRDSTKAICTYCMKEFSRGKNEKDLSTSCLMRHVRRAHPTKLIQENGSLSAGSSFSPPSLLLPPQPADVGDLSTVLSPVRLVQKMAPKIPSPDQ
IMEESVTVVSSEELSSDVSVTEKYSREEALAGSSPNLSMLHYDDASETMADRNLSLPKSTSGSRRRSAVWKHFYLSPLDSSKAVCVHCMNEFSRGKNGKDLGTSCLIRHM
WRAHRSIVLQENGGNTGIPPLYPMPPTLLPALLPPEGDLNSASLSPGKQVKESPSASSSPERLPEDLSSHTNPGDVSREDVSMLSSSDDLGEASVVSSPEKQPADTVNPR
FESGTVFQQNKKVMRRLKSEVWHHFSLAPMDSLKAVCRYCSCVISRGKKGDVGTSCLMRHLYRRHPEVVGNQKDFLGASLANSPYATLASAESSSKLTDLPAVVRKNHQG
VFPTNSKKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLLRHLQRFHGHVLKNDVSEATLSRSPGIRRPLGIELSGPSSFRDSTEKFYDSHPVAKKITSL
IAEMIALDLQPYSLVDNVGFNRLLEYLKPQYSLPSPSYFSRTAIPGMYDNVKQIIMSHLKEAESGVVHFTSGIWMSSQTREYLTLTAHWVTFASAVRPHCEDHHCSALLD
VSQIDCDYSGNSIQKQLECWWEAWVTSIGLQIGITVTDNPSIGKMLSEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSIARKLCERVHRSPRAREKLAELQKEYELPQ
HQLIQDVPSKWSTSFHMLERLIEQKRAVNEVSIECNFRELISCDQWEVMQSVCHVLRPFDAASREMSAHMSTLSQVIPMIHILSRKVEMLFGETMGIDTMLKSLKEAMAS
RLSATLHDPRYIFATLLDPRYKASLFTEEEAEQYRQDLIRELEILNSTSEDTATSNGCDSGSPLKDTGTEESLWSLAPIKRDQREKLPEDMVLAYLEEEVLEHSCDPLTY
WNLKRSSWPGLSTLAVRFLGCPPSTVPSEKLFSTPMDAGSFGQPRLMMEHFEKLIFLKVNLPLICFQY*
15 >lcl|NP_941019.2|Plus1complement(94091350..94092354) NT_039207 TSPY-like 3 Tspyl3 __SEG__ Chr2 {Mus musculus} MAWEGIGVLEATMCLPPIQERDAHPARPRVPGAEPLRPCNPAASPATAPPSSENTGENSASRVLNLDGCEKGSGNGVGTKGKTEEVTTEEDSVAAEEPAEVGEKLEWVAE
AQESLRPLDLRALIVDPLEAIQWELEAMSAQADGAHLQLVRRFGRMRRLHLARRSFIIQNIPGFWVTAFLNHPQLSAMISPRDEDMLGYLMNLEVRELRHSRTGCKFKFL
FESNPYFRNEVIVKEYECRASGGVVSIATRILWHRGQEPPALVHRNRDAVRSFFSWFSQHSLLEADRVAQIIKDDLWPNPLQYYLLGQRPYRARRSLARWSAEARPRPYG
FQSG*
16 >lcl|XP_001472086.2|Plus11243049..1243918 NT_039476 protein SET-like isoform 2 Gm9531 __SEG__ Chr9 {Mus musculus} MAPKRQSAILPQPKKPRPAAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGE
EDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVI
KDDIWPNPLQYYLVPDMDDEEGEAEDDDDDDEEEEGLEDIDEEGDEDEGEEDDDEDEGEEGEEDEGEDD*
17 >lcl|XP_001480230.1|Plus161229033..61232542 NT_078297 zinc finger BED domain-containing protein 4-like Gm15583 __SEG__ Chr1 {Mus musculus} MEDKQETCPKGDSDFVSDKVNFKTEEEDDDQTPCHSLEQVDFKSESEDMRQTDSGDEQADIRAASCACQPSGKFLAAESEDDYGSLFSQYSSTLYSVAMEAVTQSLLSSR
HISSRKKSPAWKHFFISPRDSTKAICTYCMKEFSRGKNEKDLSTSCLMRHVRRAHPTKLIQENGSLSAGSSFSPPSLLLPPQPADVGDLSTVLSPVRLVQKMAPKIPSPD
QIMEESVTVVSSEELSSDVSVTEKYSREEALAGSSPNLSMLHYDDASETMADRNLSLPKSTSGSRRRSAVWKHFYLSPLDSSKAVCVHCMNEFSRGKNGKDLGTSCLIRH
MWRAHRSIVLQENRGNTGIPPLYPMPPTLLPALLPPEGDLNSASLSPGKQVKESPSASSSPERLPEDLSSHTNPGDVSREDVSMLSSSDDLGEASVVSSPEKQPADTVNP
RFESGTVFQQNKKVMRRLKSEVWHHFSLAPMDSLKAVCRYCSCVISRGKKGDVGTSCLMRHLYRRHPEVVGNQKDFLGASLANSPYATLASAESSSKLTDLPAVVRKNHQ
GVFPTNSKKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLLRHLQRFHGHVLKNDVSEATLPRSPGIRRPLGIELSGPSSFRDSTEKFYDSHPVAKKITS
LIAEMIALDLQPYSLVDNVGFNRLLEYLKPQYSLPSPSYFSRTAIPGMYDNVKQIIMSHLKEAESGVVHFTSGIWMSSQTREYLTLTAHWVTFASAVRPHCEDHHCSALL
DVSQIDCDYSGNSIQKQLECWWEAWVTSIGLQIGITVTDNPSIGKMLSEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSIARKLCERVHRSPRAREKLAELQKEYELP
QHQLIQDVPSKWSTSFHMLERLIEQKRAVNEVSIECNFRELISCDQWEVMQSVCHVLRPFDAASREMSAHMSTLSQVIPMIHILSRKVEMLFGETMGIDTMLKSLKEAMA
SRLSATLHDPRYIFATLLDPRYKASLFTEEEAEQYRQDLIRELEILNSTSEDTATSNGCDSGSPLKDTGTEESLWSLAPIKRDQREKLPEDMVLAYLEEEVLEHSCDPLT
YWNLKRSSWPGLSTLAVRFLGCPPSTVPSEKLFSTPMDAGSFGQPRLMMEHFEKLIFLKVNLPLICFQY*
18 >lcl|XP_003084595.1|Plus1complement(3818973..3820847) NT_039240 RNA exonuclease 1 homolog LOC100503708 __SEG__ Chr3 {Mus musculus} MSLKATAKSWFPPEHSEARRVLVHPVGNFLMSYYQCPPSCCRTNQLIVIQVPSLRPGPGAHHSWLAVPSEQQHWRPQLVGRKILCSETLTTTTSSSSSSSSSSSLSSSSA
LAGENKSLILMASPSLANTTTAKRTTTTTTSSSSSSSSSSSSSSSSSNNSRATGQPPHFNTYTPQQAVYSYTFFGMKKPILTKEFKDMIPVALRQHYLGLFTEECLKFSS
SHLEAIEKAQLEEKVIYDQSPSKNKYLNVALHTLKRLRGLVPSAIPGFSKATLYSRLKGYLLTEEQRKTHGFPFAHPGRPGSAVLFSGEQLLSPTHRACCRCGTKYLVSF
SGRCLCSEPCVYHWGRVVSIPVEEGWQVRYSCCSAPMEATGCKVAKQHVQDGRKDNLHGFAKTFPKTDWEAHAGIFALDCEMSYTTHGLELTRVTVVDTDLNVVYDTFVK
PDHEIVDYNTMFSGVTEADLVDTKVRLCDVQAVLLSMFSTETILIGHSLESDLLALKFIHDTVVDTSVLFPHQRGLPYKRSLRSLISQYLSRMIQTQSGGHSSIEDARAC
MQLVIWKMQEDAKTSSPSLPQATCQKSNSLPKLPVCPSRYTQTPKMLEMPEMPKMEDILYPEGSDSDQPSQLET*
19 >lcl|XP_889413.1|Plus1complement(9017203..9017850) NT_039590 high mobility group protein B1-like Gm6115 __SEG__ Chr13 {Mus musculus} MGKGDPKKLRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAIADKARYEREMKTYIPPKRETKKKFKDPNAPKRPPSAFFLFCSGYR
PKIKGEHPGLSIGDVAKKRGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE*
20 >lcl|XP_897005.1|Plus1complement(34477377..34478570) NT_039492 G/T mismatch-specific thymine DNA glycosylase isoform 1 Gm9855 __SEG__ Chr10 {Mus musculus} MMAEVPNMAVTTGQQVPAVAPNMATVTEQQVPADAPVQEPAPEAPKRRKRKPRAAEPQEPVEPKKPATSKKSGKSTKSKEKQEKITDAFKVKRKVDRFNGVSEAELLTKT
LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKC
IYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNTDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYG
GAYGENPCNGEPCGIASNGLTAHSAEPRGEATPGDVPNGQWMAQSFAEQIPSFNNCGTREQEEESHA*
21 >lcl|XP_906829.2|Plus143632846..43634111 NT_039621 G/T mismatch-specific thymine DNA glycosylase-like isoform 5 Gm5806 __SEG__ Chr15 {Mus musculus} MDAEAALSYSLEQVQALYSFLFQQMMAEVPNMAVMTGQQVPAVAPNMATVTEQQVPTDAPVQEPAPEAPKRRKRKPRAAEPQEPVEPKKPATSKKSGKSTKSKEKQEKIT
DAFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMNDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFR
EGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNADVQEVQYTFDLQL
AQEDAKKMAVKEEKYDPGYKAAYGGAYGENPCNGEPCGIASNGLTAHSAEPRGEAAPGDVPNGQWMAQSFAEQIPSFNNCGTREQEEESHT*