SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul L    

ID / Description / Sequence
1 >lcl|XP_001085658.2|Plus13399084..3400301 NW_001112572 UV excision repair protein RAD23 homolog B RAD23B __SEG__ Chr2 {Macaca mulatta} MQVTLKTLQPQSFKIDIDPEETVKALKEKIESEKAKEASPVAGQKLIYAGEILNDDAALKEYKIDEKIFVVVMVMVTKPKAVSTPAPATTQQSAPASTTAVNFLHSNNCG
SGSNPCPCFGYHFHTRIYHSSISDSVF*TCTC*CN*TKESCRKASRDTSGY*ADIN*LYIVRFFLVKPFRRCNECTCDRSAL*EYGN*DHANGL*MRASNCSPESQFQEP
*QGSGVSCNGNPWS*NQVVVDPHQAASTGVPQSSTLAAVAATTTATTTTSSGTSP*IFMESASVSTDETNYSTEYFPTSSVTTVDRWRESSITSAN*PTQGAFYSDVK*T
SLRS*WSRRRRWRWQWRNCRTWKWSYELHSSNTSGKRSYRKVGIPEGLVIQAYFACEKNKNLAADFLLQQTFDED*
2 >lcl|XP_001088106.1|Plus1726436..727221 NW_001218166 replication protein A 30 kDa subunit RPA4 __SEG__ ChrX {Macaca mulatta} MSNSGFGSYGSISAADGGSGGSDQLCERDAAPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDTVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGR
EKVKQVTPLSVGAYVKVFGILKCPTGTKTLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVFPSEVDDAGDNDESHRSFIRDEVLRLIHECPQQEGKSI
YELQAQLCDLSLKAIKEAIEYLTVEGHIYPTVDQEHFKSAD*
3 >lcl|XP_001090078.1|Plus1738803..740374 NW_001100390 lysine-specific demethylase 4D-like isoform 1 KDM4D __SEG__ Chr14 {Macaca mulatta} METMKSKANYGQNPNCNIMIFHPTKEEFNDFDKYIAYMESQGAHRAGLAKIVPPKEWKARETYDNISEILIATPLQQVASGRAGVFTQYHKKKKAMTVGEYRHLANSKKY
QTPPHQNFEDLERKYWKNRIYNSPIYGADISGSLFDENTKQWNLGHLGTIQDLLEKECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHLGEPKTWYVVPPEHG
QRLERLARELFPGSSRGCGAFLRHKVALISPTVLKENGIPFNRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYGKMASQCSCGEARVTFSMDAFVRILQP
ERYELWKRGQDRAVVDHMEPRVPASQELSTQKEVQLPRRAALGLRQLPPHWARHSPWPLAARSGTRCHTLVCSSLPRRSAVSGTATQPRAAAVHSSRKPSSTPSSTPGPS
AQIIHPSNGRRGRGRRPQKLRAQELTLQTPAKRLLLAGTTCTVSGPEPEPLPEGGALMDKPVPLNPGLQHPVKASRCSWAPVP*
4 >lcl|XP_001092365.1|Plus1complement(9356253..9357506) NW_001122911 TSPY-like 5 TSPYL5 __SEG__ Chr8 {Macaca mulatta} MSGRSRGRKSSRAKNRGKGRAKARVRPAPDDAPRDPDPSQYQSLGEDTQAAQVQAGAGWGGLETAASAQLLRLGEEAACRLPLDCGLALRARAAGDRGQAAARPGPGKAA
SLSERLAADTVFVGTAGTVGRPKNAPRVGNRRGPAGKKAPETCSTAGRGPQVIAGGRQKKGSAGENTSVSAGEEKKEERDAGSGPPATEGSMNTLENVQLKLENMNAQAD
RAYLRLSRKFGQLRLQHLERRNHLIQNIPGFWGQAFQNHPQLASFLNSQEKEVLSYLNSLEVEELGLARLGYKIKFYFDRNPYFQNKVLIKEYGCGPSGQVVSRSTPIQW
LPGHDLQSVSQGNPENNRSFFGWFSNHSSIESDKIVEIINEELWPNPLQFYLLSEGARVEKGKEKEGRQGPGKQPVETTQPGVSQSN*
5 >lcl|XP_001094383.1|Plus1complement(2625402..2625827) NW_001100390 nuclear nucleic acid-binding protein C1D-like LOC700581 __SEG__ Chr14 {Macaca mulatta} MAGEEINEDYPVEIHEYLSAFENSIGAVDETLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVTPKEHPVKQELERIRVYMNRVKEITDKKKAGKLD
RGAASRFVKNALWKPKPRNASKVANKGKSKS*
6 >lcl|XP_001094689.1|Plus1complement(3328..3753) NW_001124968 nuclear nucleic acid-binding protein C1D-like LOC706956 __SEG__ Chr9 {Macaca mulatta} MAAEEINEDYPVEIHEYLSAFGNSIDAVDEMLKNMMSVSRNELLQKLDPLEQAKVDLISAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEMTDTKKAGKLD
RGAASRFVKNALWEPKPKNASKVANKGKSKS*
7 >lcl|XP_001098191.1|Plus1complement(8064957..8065988) NW_001099001 aspartic peptidase, retroviral-like 1 ASPRV1 __SEG__ Chr13 {Macaca mulatta} MGSPGASLGIKKALQSEQATALPASAPAVSLPTAPAPSCLPKAGQVIPALLPEAPFSSVIAPPLLCGFLFLAWVAAEVPGESSRMAGSSARSEEGRRQHAFVPEPFDGAN
VVPNLWLHRFEVINDLNHWDHITKLRFLKESLRGEALDIYNGLSPQDQGDYGTVKETLLKAFGVPGAAPSHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVV
HPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSLGKLKLKAQFLVANASAEEAIIGTDVLQDHNAVLDFEHRTCTLKGKKFRLLPVGGSLEDEFDLELIEE
DPSSEEGRQEFSH*
8 >lcl|XP_001098673.1|Plus1complement(889412..890284) NW_001108727 protein SET SET __SEG__ Chr1 {Macaca mulatta} MAPKRQSPLPLEKKKPRPPPALGPEDTSASAGLLKKGEKEQQEAIEHIDEVQNEIDRLNEQDSEEILKVEQKYNKLCQPFFQKRSELIAKIPDFWVTTFVNHPQMSALLG
EEDEEALHYLTKVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPEIFFTWFTDHSDARADKLGEV
IKDDIWPNPLQYYLVPNMDDEEGEGEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDEE*
9 >lcl|XP_001099639.1|Plus11908892..1909773 NW_001111321 nucleophosmin-like isoform 1 LOC702389 __SEG__ Chr20 {Macaca mulatta} MEDSMDMDMSLLRPQNYLFGCELKADKDDHFKVDNDENEHQLSLRTISLGAGAKDELYIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGAFEITPPVVLRLKCGSGPVH
ISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDEDDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPR
SKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFQMTDQEAIQDLWQWRKSL*
10 >lcl|XP_001099820.1|Plus14798463..4799653 NW_001100391 protein DDI1 homolog 1-like LOC704423 __SEG__ Chr14 {Macaca mulatta} MLITVYCVRRDLSEATFSLQVSPDFELRNFKVLCEAESRVPAEEIQIIHMERLLIEDHCSLGSYGLKDGDVVVLLQKDNVGPRAPGRAPNQPRIDFSGIAVPGTSSSRPQ
HPGQQQQRTPAAQRSHGLASGETVGVPQGLGSPGLIRSMLLSNPHDLSLLKERNPPLAEALLSGSLETFSQVLMAQQREKALREQERLHLYTADPLDREAQAKIEEEIRQ
QNIEENMNIAIEEAPESFGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEDQPMDMLL
GLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLPEGELPLCSRMVNGKDEPSDKEITHSVMDSGRKEH*
11 >lcl|XP_001106417.2|Plus1complement(4252531..4253163) NW_001121199 high mobility group protein B2-like LOC715948 __SEG__ Chr7 {Macaca mulatta} MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPESSVNFAEFSKKCSERWKTMSAKEKSKFEGMAKSDKVCYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHR
PKIKSEHPGLSTGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYQKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEEDEDEEEEEEDEE*
12 >lcl|XP_001108535.1|Plus1926963..928024 NW_001095146 testis-specific Y-encoded-like protein 3-like LOC712128 __SEG__ Chr10 {Macaca mulatta} MADERAGTPEAAARPPPGPAREGDAHTAPAARAREAAGRRSLHPAAGPRTALLCLGRGEAASAATTPSLENGRVRDEAPETCGSEGLGARAGAGEKAEDATMEEGAIFQE
EPAEEVEKQQVGEKLVGEEKQEVGAEAQEGPGLLNLGALIVDPLEAVSAQADRAYLRLERRFRRMHRSHLARRSFIIQNIPGFWVTAFLNHPQLSAMISLRDEDMLCYLM
NLEVKELRHSRTGCKFKFRFWSNPYFQNKVIMKEYECRASGRVVSIATRIRWHRGQEPPALVHRNRDTVRSFFSWFSQHSLPDADRVAQIIKDDLWPNPLQYYLLGDRPC
RARGGLARWPTEAPSRPYGFQSG*
13 >lcl|XP_001111467.1|Plus1285328..288843 NW_001095206 zinc finger BED domain-containing protein 4 ZBED4 __SEG__ Chr10 {Macaca mulatta} MENKLKTCPKEDGDFVSDKIKFKIEEEDDDGIPPDSLERMDFKSEQQDMKQTDSGGERAGLGGTGCSCKPPGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSR
NMSSRKKSPAWKHFFISPRDSTKAICMYCVKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQENGSVSAVSSFPSPSLLLPPQPADTGDLSTILSPIKLVQKVTSKIPSPD
RITEESVSVVSSEEISSDMSVSEKCGREEALVGASPHLPALHYDETAENLAEKSLPLPKSTSGSRRRSAVWKHFYLSPLDNSKAVCIHCMNEFSRGKNGKDLGTSCLIRH
MWRAHRAIVLQENGGTGIPPLYSTPPTLLPSLLPPEGELSSVSSSPVKLVRESPSASSSPDRLTEDLQSHLNPGDGLMEDAAALSSSDDVGEASASSPEKQQADGLSPRL
FESGAVFQQNKKVMKRLKSEVWHHFSLAPTDSLKAECRYCGCAISRGKKGDVGTSCLMRHLYRRHPEVVGSQKGFLGASLANSPYATLASAESSSSKLTDLPTVVTKNNQ
VMFPVNSKKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLLRHLQRFHSNVLKTEVSETARPSSPDIRVPRGTELSGASSFDDTNEKFYDSHPVAKKITS
LIAEMIALDLQPYSFVDNVGFNRLLEYLKPQYSLPAPSYFSRTAIPGMYDNVKQIIMSHLKEAESGVIHFTSGIWMSNQTREYLTLTAHWVSFESSARPRCDDHHCSALL
DVSQVDCDYSGNSIQKQLECWWEAWVTSTGLQVGITVTDNPSIGKTLSEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSLARKICERVHRSPKAKEKLAELQREYALP
QHHLIQDVPSKWSTSFHMLERLIEQKRAINEMSVECNFRELISCDQWEVMQSVCCALKPFEAASREMSTQMSTLSQVIPMVHILNRKVEMLFEETMGIDTMLRSLKEAMV
SRLSATLHDPRYVFATLLDPRYKASLFTEEETEQYKQDLIRELELMNSTSEDAAASHRCDAGSPSKDSAAEESLWSLVAKVKKKDPREKLPEDMVLAYLEEEVLEHSCDP
LTYWNLKKASWPGLSALAVRFLGCPPSIVPSEKLFNTPTENGSLGQSRLMMEHFEKLIFLKVNLPLIYFQY*
14 >lcl|XP_001111828.1|Plus123247616..23248947 NW_001116523 TSPY-like 1 isoform 2 TSPYL1 __SEG__ Chr4 {Macaca mulatta} MSGVDGVERTPPLQTHSIIISDHVPSDPDAHQCLKLRDQSETTQVMAEPGEGGSETIALPPPQPSEEGGVPQDPAGRGSTPQIRVIGGRGHVAIKAGQEEGQPPAEGLAA
ASVVVVAVDRSLKKGVQGGEKALEIYGAERSASELPAGAGAGAENDTEEVKTGKCATVSATVAEGESAEVVVKEGLAEKEVVEEQMEVEEQLPEGEEIEVAEEDRVEEEA
REEEGPWPLHEALRMDPLEAIQLELDTVNAQADRAFQQLEHKFGRMRRHYLERRNYIIQNIPGFWMTAFRNHPQLSAMIRGQDAEMLRYITNLEVKELRHPRTGCKFKFF
FRRNPYFRNKLIVKEYEVRSSGRVVSLSTPIIWRRGHEPQSFIRRNQDLICSFFTWFSDHSLPESDKIAEIIKEDLWPNPLQYYLLREGVRRARRRPLREPVEIPRPFGF
QSG*
15 >lcl|XP_001114511.1|Plus1complement(15851883..15853109) NW_001099000 testis-specific Y-encoded-like protein 6-like LOC716697 __SEG__ Chr13 {Macaca mulatta} MSLLESPHRPATLDRAPEDPHQGQRSREKSKATQVMADVFEGRLEPVVLPPPQLPEEGVAPQDPADSGRTFHILVDGSRSRGAIKAGQEVTLPPAEGLEAASISLTTDGS
LKNGFPGEETPGLDGEKAVETCGAGRSESEVIAEGKAEDVKPEECAMLSAPVDEKLGGEEMDMAEGNRATDEVNKDAGPGPGPLNVGLHLNPLESIQLELDSVNAEADRA
LLQVERRFGQMHEYYLEQRNDIIRNIPGFWVTAFRHHPQLSAMIRGQDAEMLSYLTNLEVKELRHPRTGCKFKFFFRRNPYFRNKLIVKVYEVRSFGQVVSFSTLIMWRQ
GHGPQSFIHRNRHVICSFFAWFSDHSLPESDRIAQIIKEDLWPNPLQYYLLDEDAHRARRRPNREPVEIPRPFGFQSG*
16 >lcl|XP_001116615.2|Plus1complement(2076592..2077218) NW_001096626 replication factor C subunit 1-like LOC716501 __SEG__ Chr11 {Macaca mulatta} MRVLPGELMRGFMTQFPTFPGWLGKHSSTGKHGRIVQDLALHMSLRTYSSKRTVNMDYLSHLRDALVQPLTSQGVDRVQDVVALMDTYYLMKEDFENIMEISSWGGKPSS
FSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKKKSSKPSKPEKDKEPRKGKGKSSKK*
17 >lcl|XP_001118506.2|Plus1complement(3662533..3663675) NW_001100361 flap endonuclease 1-like isoform 1 FEN1 __SEG__ Chr14 {Macaca mulatta} MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQ
LQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQ
EQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPSKYPVPENWLHKEAHQLFLKPEVLDPESVELKWSEPNEEELVKFMCGEKQFSEERIRSGVKRLSK
SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK*
18 >lcl|XP_002803971.1|Plus123270016..23271260 NW_001116523 testis-specific Y-encoded-like protein 4-like LOC716137 __SEG__ Chr4 {Macaca mulatta} MSGLDGGNKLPLAQTGDLAAPDHASGDPDLDQCQVLHEETEATQVMANTGGGSLETAAEGGASRDPVDCGPALRVPVAGSRGCVATKAGQEDAPPSTKGLEAASASEAAD
NSQKNGCQLGEPRGPAGQKALEACGAGGLGSQMIARKKAKEVTTKKCAMSAAVEKEGEAGAVMEEKKVVQKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQ
ADRAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMLRYMINLEVEELKHPRAGCKFKFIFQGNPYFRNEGLVKEYERRSSGRVVSLSTPI
RWHRGQDPQAHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKGELWPNPLQYYLMGEGPRRGIRGPPRQPVESARSFRFQSG*
19 >lcl|XP_002804240.1|Plus13191209..3191478 NW_001118159 barrier-to-autointegration factor-like LOC694870 __SEG__ Chr5 {Macaca mulatta} MTTSQKHRDFVAEPMGEKPVGSLTGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEGLFREWLKDTCGANAKQSRDCFGCLQEWCDAFL*
20 >lcl|XP_002805435.1|Plus1<13728435..13728713 NW_001122906 x-ray repair cross-complementing protein 6-like LOC100426084 __SEG__ Chr8 {Macaca mulatta} LDSLVDEFEELVYPPDDNPDGKVTKRKHNNEGSRSKRPKLEYSEEELKTHTSKGTMGKFTLPKLKGAPWAYRLKSGLKKQELLETLIKHFQE*
21 >lcl|XP_002806169.1|Plus1complement(99860..101944) NW_001218091 zinc finger BED domain-containing protein 1-like ZBED1 __SEG__ ChrX {Macaca mulatta} MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDPL
AVKAGHGYDSKKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAVREVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGL
GAPNCLSVGSRCLKTFEVPEENTAETITRVLYEVFIEWGISAKVFGATTNYGKDIVKACSLLDIAVHMPCLGHTFNAGIQQAFQLPKLGALLSRCRKLVEYFQQSAVAMY
MLYEKQKQQNVAHCMLVSNRVSWWGSTLAMLQRLKEQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFKQVAEMLSASRYPTISMVKPLLHMLLNTTLNIKETD
SKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYKRLPFLSAFERQQVENRVVEEAKGLLDKVKDGGYRPAEDKIFPVPEEPPVKKLMRTSTPPPTSVINNMLAE
IFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPLLPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRLAPAHVDEQVFLYENARSGAEAEPE
DQDEGEWGLDQEQVFSLGDGVSGGFFGIRDSSFL*