SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom L    

ID / Description / Sequence
1 >lcl|XP_001362138.1|Plus12183563..2185650 NW_001581989 zinc finger BED domain-containing protein 1 ZBED1 __SEG__ Chr7 {Monodelphis domestica} MENKSLESSPSDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPDEFCEFVKSNTEQMREAFATAFSKLKPESSQQVVQDTL
IMKTSHSYENKKHQELTSAVISLICEGMYPSSIVDEPTFKTLLKTADPRYELPSRKFFCTKAIPEKYNAVREIVLKELTDILWCGISTDIWRSQNQNRSYVTLAVHFLNS
SSSHCLTVNSRCLKTFEVPEENTAETITRVLYEIFIEWGINTKVFGATTDYGKDIVKACSLLDIPVQMPCLGQTFNAGIQQAFQLPKLGSLLTRCRKLVEYFQQSTVAMY
MLSEKQKQQNIMHCMLVSDRVSWWGSTLAMLQRLKEQQFIIAAVLVEDSNNHHLMLETSEWNTIEGLVDLLHPFKQVAEMMSASKYPTISMVKPLLHMLLNTTLNIKEND
SKEISMAKEVIAKELSTTYQETPEIDMFLNVATFLDPRYKKLPFLSAFERQQVENRVVEEAKSLLEKVKENSFRPEEKLFSLSEEPPVKKMIISSTPPPTSAINNMLAEI
FCQTGGVEDQEEWHAQIVEELSNFKSQKVLGLNEDPLKWWSDRLALFPVLPKVLQKYWCILATRVFPERLFGSSANVVSAKRNRLAPAHVDEQIFLYENTRNGSEAEPED
EDEGEWGLEQEQIYTLSDTVNVSNNFFNIRDSGFI*
2 >lcl|XP_001364342.1|Plus1complement(1236051..1236320) NW_001581894 barrier-to-autointegration factor-like LOC100014813 __SEG__ Chr3 {Monodelphis domestica} MTTSQKHRDFVGEPMGDKPVRCLAGIGEVLGQKLECRGFDKAYMVLGQFLVLKKDEDLFREWLNDICGANAKQSQDCFECLREWCDAFL*
3 >lcl|XP_001365215.1|Plus134378036..34379106 NW_001581976 serologically defined colon cancer antigen 3 homolog LOC100016677 __SEG__ Chr6 {Monodelphis domestica} MSGYTRRKGLTPLSRARTLVIQDEDNLEDLDEANPFSFKEFLKTKNLGLSKEEATNARIYTKESTRHTLGLENNCLTSKYGLDYEEPFFQDTTGAGDLLEEDEDDDNWSG
TYLPSAMEQTHASRLATSTSPRSSYISFFSNPSDLSGIESLDPWTLSESDPCISPSSQVNNTNKEFAGHGEYLGDSHFRSLQINYETLKEENSKLRRKISEIQNFSESQT
EMVRTLERKLEAKMIKEESDYHDLESVVQQVEKNLELMTTRAVKAENQVTKLKQEINMLQAQFTNSKRENEALRSGQCSNLTVVKQNTDVALQNLRAVMNNAHSSIKQLL
SGAETLNLVAEILKSIERISEIKEEP*
4 >lcl|XP_001365353.1|Plus140157939..40160674 NW_001581989 DNA ligase 4 LIG4 __SEG__ Chr7 {Monodelphis domestica} MATSQPSRTVASQVPFADLCSTLERIQKSKARPEKIKYFKEFLDSWRRFHDALHKKEKEVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPKEGKDAQKLL
NYRTPTGTRGDAGDFAMIAYFVLKPRCPKQGSLTIQQVNDILDLIASNNSANRKDLVKKNLLQLITQSSALEQKWLIRMIIKDLKLGFSQQTIFSLFHRDAAELHNVTTD
LEKVCRQLHNPLVGLSDISITLFSAFKPMLAAVADIQRIEKDMKHQGFYIETKLDGERMQMHKDGDVYKFFSRNGYDYTEQFGDSSLNGSLIPFIHKAFKTNIQNCILDG
EMMAYNPNTQTFMQKGSKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHEALRKRYEIISTVFTPIKGRLEVVQKTEANTKKEVIDALNEAIDKREEGIMIKNPLSIYKP
DKRGEGWLKIKPEYINELMDELDILIVGGYWGKGLRGGMMSHFLCAVAETPPPGEKPSVFYTLCRVGSGYTMKELYDLGLKLSKHWKPFHKRAPPNSILCGTEKPEVYIE
PCNSVIVQVKAAEIVSSDMYKTNCTLRFPRIEKIREDKEWYKCMTLDELENLRGKASGKLASKHLFIGGDDEEPQGKKRKAIKVKKTIGIIEHLKAPDLSNINRISNVFE
DVEFCVMTGTDSHSKPDLESHIAELGGYIVQNPGPDTYCVIAGTENVRVRNIISSNKHDVVKPEWLLECFKAKECVPWQPQFMIHMCPSTKEHFACEYDCYGDSYFADTD
VVQLKEVFSRIKNVKEESPNEMASVIADLEDRYSWDNCPLSMFRHCTMYVDIYAIINDLTTQIEGTRLAIKALELRFHGAKVVSCLEEGVSHVIIGEDHSRVEEFKAFRR
TLKRKYKILQELWVTDSLKKGELQEENQYLI*
5 >lcl|XP_001367324.1|Plus1complement(1211626..1214880) NW_001587040 structural maintenance of chromosomes protein 6-like LOC100012945 __SEG__ ChrX {Monodelphis domestica} MAEGREDLVPLAAEEQQGAAKAEPEGELAEQEEQESLLLQDEPHGSAAASPLSVGEVGIVESIQLENFMCHSRLGPVQFGPNVNFVVGQRGKSALLTALLLGLGGKSLGS
PLKEFVKDGEASANILITLSNRGENAYKPDSYGDSIIVHQCISVSGTVSYKLKDQSGSVITSKKAELAEILEHFNIRVDNPMTILQQEMGRQLLQTRSDGERYKFFQKVT
QLEQMHNDYLCILERKARTQDQIEQGEKQLLELKQQGIEVEQCFQSMAASRKRLEDLKHEMAWAVVNESERQIEDMISNINIGDQDTIRLNQKLEASQAKFNETTEKLKE
VQEKLDKLNKETIELEIESIQARDNINRKKKAYEEAEDLYNSSQNELKQLEKEKEHCNQMENLKKSMEQSKLEKQEKIAMLKEELNKYKDQENSFFEKLEHLQEAIEKDN
EEHSRLKREVSDVQQTLNDKQQQLNHLKDCKASPLKIFEPQIPALLEAIDNADREGLFTTKPKGPLGGYIHLQDPEFALAVEACLKDLLLAFCCNTFKDEEVLQTLMKRF
YPVGSPRPQIIVSAFKNEIYDMTNRAAHHPEFPTVLTALKIDDAVVANALIDMRGIESVLLIKSNSLARTVMQVQEPPKNCREAFTADGDQVFERRYYSCDKSRPTYLID
FEVEINHLEKVVENTVAQLSVYQQCANSLENDIRKNEETVNNHRLHLKEIAIRVIKINMQIKDLEKEGTQSIGFSTQEKVKEIEKQMEQVEEKMKVQMEEMKDLRQEIID
AEQRHESIKMKIQQVQELSESFRQELSQINLEMDSEKRCLRHYQDRLKHHTNSLQVKKEELTKKEKELEKETAQAKYICPERKEIEKSTAALDKEIAFLKQKIQSENTRH
RSREEIIRQFQQIKERYNALDVKVKNLRNCIKSLDQTSVQRYELYQQFRRSLALRCRLYFDSFLSQLALSGEIRFDHAHETLSVRVQRGEGNTAGLGSIELQSGSENSFS
NFFFILSLWYITEGPFRCLDAFDSYLDPSSRRIALNMILKIAQSQQFRQFILLTPQSLSFLSPSSLIKIIHVPDTEREQRTLHFRRVREDEEED*
6 >lcl|XP_001367711.2|Plus13990307..3991143 NW_001581838 protein SET-like LOC100013310 __SEG__ Chr1 {Monodelphis domestica} MSAPAAKVSKKELTTNHKEALETLEKEQQEAVERIDEVQNEIDKLNEQASAEILKVEQNYNQLRQPFFQKRSEWIAKIPDFWVTTLISHPQLSSLLGEEDEEALHHLTRI
EVIEFEDVKSGYRIDFYFEENPYFENKVISKEFHLDESGDLASKSTEIQWKSGKDLTTRPCQILNKGGRKRLREEPDSFFTWFTDHTDAGADELGELIKDDIWLNPLQYY
LVSDIDHEEGEGEGNGDEIVGLEDSDGDEEDSEEDEEDDDDEEGDDEGEEGKDAGENE*
7 >lcl|XP_001368108.1|Plus1complement(2145163..2145888) NW_001587040 three prime repair exonuclease 2-like LOC100013741 __SEG__ ChrX {Monodelphis domestica} MAELPTCETFVFLDLEATGLPNAHPEIAEISLFAIHRFSLEHPERDESGTLQLPRVLDKLTLCMCPEQNFTPKASEITGLSNQNLADNHKAGFNGAVIRALREFLKRQKS
PICLVAHNGFDYDFPLLRTELQRLGADLPGGTVCLDTLPALRGLDKVHHHSTRASHGKKSYSLGNLYRRYFDDEPQAAHSAEGDVYALVMVFLHRAQELLQCVQTEAQNW
DEIQPMYTPRKRRLSGGSLDA*
8 >lcl|XP_001369936.1|Plus1complement(67915889..67916158) NW_001581837 barrier-to-autointegration factor-like LOC100025920 __SEG__ Chr1 {Monodelphis domestica} MATSQKHRDFVAEPMGDKPVGCLAGIGEVLGKKLEDEGFDKAYVVLGQFLVLKKNEDLFREWLRKTFGANARQSRDCFVCLQEWCNAFL*
9 >lcl|XP_001372665.1|Plus1148808..152377 NW_001587054 DNA excision repair protein ERCC-6-like LOC100020004 __SEG__ ChrX {Monodelphis domestica} MVSFLSLYLQCPAYSKCLSLSVYRYVKEAKEATKSGNIEEALKLFYLAKAIYPNDKVLSRIQRLQEALEELSVEETDDFVNVCNSGLMLYGELHDRLFEYQKEGVAFLYS
LYKDKRKGGILADDMGLGKTVQIIAFLSAMFDAELVRHVLLIMPSSLISTWVKEFAKWTPGMRVATFHGSSKSERTKNLTRIQRKSGVAITTYQMLINNWQQLSQMDGKE
FVWDYLILDEAHKIKSSSTKSSKIARCIPVKNRILLTGTPIQNNLYELWSLFDFACQGSLLGTSKTFKMEYENPIIRAREKDATIGEKALGFKISENLMTLIKPYFLRRT
KEDVQKKSANNKQSSLPEKDPGGADFCEMPSLSRKNELIIWVRLVPLQEEIYRKFVSLNHIKQLMIETRSPLAELNVLKKLCDHPRLLSARVCSLLGLKGSSLSGGDESQ
LVHSDIQMDQIPHDSLMQESGKVIFLMALLKRLQDEGHQTLVFSQSRKLLDIIEHLLKAEHFKTLRIDGTVTHLSERQRRIDLFQQSRGVSVFLLTSQVGGVGLTLTAAT
RVVIFDPSWNPATDAQAVDRVYRIGQKENVVVYRLITCGTVEEKIYRRQVFKDSLVRQTTGDKKNPFRYFTKQELRELFTLGDFRSSATQLQLHSLHAGHRKTDKKLEEH
IAYLHTLGIAGISDHDLMFTHDIPEELEEGQSQYIQERVQKAQLLVELESQNNELLMSNIKSGIDETWLKEATSSRPKKKGPEFNVLHHLSPPIIDLVQEDSLRSGIATL
NITEDSKTCDLSGMDVDMSVKQSGVDVPEHKADDELRTTFSSEEGHEMEISKTSHPNESHISIDTTQDSVKQLVQEIAKADAEPNPDQIIPISPEKSLKLGTSINMSTCP
SAWENSGPNQSRLGKESLVSSLQNIGDFNLFLEDSLGSDQNLSNLPLEPTERENITWELADNPEGKSSSVRSLQLDDCSDRESELEDEIICVKTRYKANKIVSDDDDDSV
IEGMLSPLPNPLLTQFSSTPKSNRSQSELFFSEMCSGGNNSAIARRSLASRRSLINVVLDHVEDMEEDACEPKSTDEYLSEEEEEAAAAAAAESEHSEEEPTEETPLFQR
EACSLPGAHTDSAPGASNKDSQEMPEHNPSSAAEATDEYETLVRRGKELKESGKTQEALNCLLKALDIQSTDPQVMLMTLNLYKLLNQT*
10 >lcl|XP_001375011.2|Plus139058983..39059867 NW_001581981 three prime repair exonuclease 1-like LOC100023478 __SEG__ Chr6 {Monodelphis domestica} MGLEAASSRPMETLVFMDLEATGLPFSQPKVTELCLVAIHRHALEASQQAPPPGGASSVPPTPRVADKLCLCVAPGKACSAAASSLTGLNTAMLTAHRRGPFDSALADLL
QAFLRRQRPPLCLVAHNGDRFDFPLLQAELSAAGLGTDALSGAFCADSITALRALDRSGPPIESSQRKSYSLGNVYARLFGQAAPDTHTAEGDVLALVSVCQARPRPLLQ
WIDTNARPFSSVRPMYGGGAGTDPGGTHDAVTRTQYRKPRAAAGAASATSGDASPATRKRRGRSAAPSRAGSLF*
11 >lcl|XP_001376061.1|Plus14434992..4438513 NW_001582002 zinc finger BED domain-containing protein 4 ZBED4 __SEG__ Chr8 {Monodelphis domestica} MDKNQETCSKMDNSFVLDKINFKVEPEDNTTNHSVERMDFKSEQEDVRQTDSSDEQAEFKGKTCSGRHPGKCSSADHEEDYGTLFSQYGSTLYDVAMEAVAQSLLSSRNI
SSRKKSPAWNHFFISPRDSTKAICMYCMKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQENGSMPSISSFPSPSLLLPPQPADVSDLSTVLSPIKLVKKMASKIPSPDRG
IEESGSVVSSEEMSSDLSISEKYNKEEALVVSSPHLPSAQYDEVVENVAEKTVPVPKSTSGSRRRSAVWKHFYLSPLDNSKAVCIHCMNEFSRGKNGKDLGTSCLIRHMW
RAHRSIVLQENGGGTSIPPLYSAPPTLLPSLLPSEGDLNSVSSSPGKLVKESPSASSSPDRLTEEIHAHLNPGDALMEDVSVLSSSDDIGEASLVSSPEKQGDGLSTLIF
EPGTVFQQNKKIMKRLKSEVWHHFSLSPTDNLKAVCRYCSCMISRGKKGDVGTSCLMRHLYRRHPEVIGNQKSFIDASLANSPYATLASAECSSSKLTDLPTMVSNDNQV
IFPVSSKKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLLRHLQRFHSNVLKNDASETVLPSTAEIRVPLSTELLASSSFDETNEKFCDSHPVAKKITSL
VAEMIALDLQPYSFVDNIGFNRLLEYLQPQYSLPSPSYFSRTAIPDMYDNVKQIIVSHLKEAESGVIHFTSGIWMSSQTREYLTLTAHWVTFESSVRPHCEDYHCSALLN
VSQVDCDYSGVSVQKQLEYWWEAWVTSVGLQIGITVTDNQSIGKTLNEGEHSSVPCFGHTINLIVNEAIKSQRMVQNLLSIARKICERVHRSAKAKEKLAELQKEYELPQ
HHLIQDVPSKWSTSFHMLERLIEQKRAIDEMSIECSFREQISCDQWEVMQSVCHALKPFEAASREMSTHVSTLSQVIPMIHILNRKIEMLFEETMGIDTMLKSLKEAMVS
RLSSTLHDPRYIFATLLDPRYKASLFTEEEAEQYKQDLIRELEILSSTSDDKPVSNGCDIGSPSTNSVAEDSLWSLMAKLKKKDLKDKTKLPEEMVLAYLEEEVLEHNCD
PLTYWNLKRSAWPVLAKLAVRFLGCPPSIVPSERLFSSTSSENSSFGQSRLMMEHFEKLIFLKVNLPLIYFQY*
12 >lcl|XP_001377513.1|Plus1complement(581947..582672) NW_001587034 three prime repair exonuclease 2-like LOC100027124 __SEG__ ChrX {Monodelphis domestica} MAELPTCETFVFLDLEATGLPNAHPEIAEISLFAIHRFSLEHPERDESGTLQLPRVLDKLTLCMCPEQNFTPKASEITGLSNQNLADNHKAGFDGAVIRALWEFLKRQKS
PICLVAHNGFDYDFPLLRTELQRLGADLPGGTVCLDTLPALRGLDKAHHHSTRASHGKKSYSLGNLYRRYFDDEPQAAHSAEGDVYALVMVFLHRAQELLQCVQTEAQNW
DEIQPMYTPRKRRLSGGGLDA*
13 >lcl|XP_001377738.1|Plus1complement(78132640..78132894) NW_001581968 barrier-to-autointegration factor-like LOC100027451 __SEG__ Chr5 {Monodelphis domestica} MTTIQKLHDFMAKPMGDKPVQCLADIREMLGKVLEDKGYDKAYVVLGKFFMMKKDKDFFWEWHRVICGANAKQSQCVKWKGIMR*
14 >lcl|XP_001377926.1|Plus183752617..83753744 NW_001581900 protein DDI1 homolog 2-like LOC100027707 __SEG__ Chr3 {Monodelphis domestica} MLLTVYCVRRDSTEMTFSLQVDRDFELHNFRVLCELESGIPADETHIVFAENSLEDNHRSLASYGLKDGDVVILRQKANERAGSPGQFTGIDFSSIAVPGPSGTSRSPHQ
MQPPLSSGNVVQVAESPAALRDMLLSNPHELAVLRERNPSLAEALFSGDLEEFTRVLIEQQEDQALRDEERFRLYVADPFDLEAQAKIEEAIRQQNIEENMSIAMEEAPE
SFGQVVMLYINCKVNGHPVKAFVDTGAQMTIMSQACAIRCNILRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLACSFSIIEEQPMDMLLGLDMLKRHQCNIDLKK
NVLVIGTTGTHTAFLPERELPECARLAYDPGQDDLRMEEKLYKKL*
15 >lcl|XP_001378206.1|Plus147176470..47178197 NW_001581871 n-acetyltransferase ESCO2-like LOC100028093 __SEG__ Chr2 {Monodelphis domestica} MPPSPSGTPKKEISQINDINKENICYLFQGHHVSNQFNKYPLETACAVQKGDGVIPLKSPQQGSPFKSAMSTRSFYNRDKWYLNPLERKLIKESRSLCQKNDWGYNNPLS
TLTEKKKHQKVFKKTNSKVKRNSTPKYHGSYKGIKTMTRNNVKPQQNRVIFKPTTGQEDNNHELDKSLAPAPRVLSLKVKPQVTLQSGAAFFVAGKKSHSLIKKVILDGQ
TTSELKANKFKPIVMMNPGLPAINEKETFESPKNKVISSKKWKLVEKSFSLKESHSENSKKESPESVTYPIFSTTSINHKSSLAFLEEPSSLGSGTTMNESSIVLKELQA
QKTNKNTRELNKQLKDQFIIDAGQKHFGAIVCKSCGMYTAASPEDEEQHAHCHQRFLEGVKYVGWKKEHIVAEFWDGKIILVLPGDPKYAIRKAEDVCELVDNELGFKQV
IPNCPSKIKTFLYISDEKKVIGCLIAEKIKQAFRVLSEPSSPDSPNHQMFDNQRDWQCSSTPEPALCDISRIWVFSLMRRKGIARRLVDTVRNWFMFGCFLSTNEIAFSD
PTPDGKAFATKYCNTPNFLVYNFIS*
16 >lcl|XP_001381443.2|Plus1132506243..132507022 NW_001581961 ribonuclease H1-like LOC100032427 __SEG__ Chr4 {Monodelphis domestica} MFYAVRKGRQPGVFLTWSECQAQVNRFPSARFKRFSTPDAAWAFVRSASPDHSKEQKKKCEIQIPEVNLERILCESSSDEEGEEPCPKIAKRSPDCSESSLNKNTFCYMG
DAAVVYTDGCCSSKGKKPRAGIGVYWGPGHPLNVGDRLTGRQTNQRAEIHAACKALEQAKDQNINKLVLYTYSMCTVNGITNRIKDWKKNGWKTSAGKKVSNKDDFVKLD
RLTRGIDIQWIHVPCHSALEGNEEADKLAREGAKKSHST*