SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab L    

ID / Description / Sequence
1 >lcl|XP_001488130.1|Plus1complement(48220815..48221453) NW_001867387 high mobility group protein B1-like LOC100050136 __SEG__ Chr1 {Equus caballus} MGKGEPKKPRGRMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKIKKKKEAEEDEEDEEDEEEEEVEDEEEDYDDE*
2 >lcl|XP_001491922.1|Plus11678217..1679008 NW_001877045 replication protein A 30 kDa subunit-like LOC100057104 __SEG__ ChrX {Equus caballus} MSKNGFGSYGSISAAGGASGGNDQPSQGGGTAPATKLFRSRALIQEIIPCSVNQLLTSTLVDDVFQIRGVEVSQVSIVGIIRQAEMAPNYVLYKIDDMTTKPIEVRQWVS
NEKAKQGVTLLPVGVYVKVFGTLKCSAGVKCLEVLNIRVLESMNEFTAHVLETGHAHMMLPKAYQLAPVQNAPVTPLEMDGVQESGEDCPDYILKEVLRLIRECPRKEGK
SLQQLQTELCSLSIKTIKQAIDYLTIEGHVYCTVDGEHFKSAD*
3 >lcl|XP_001493940.1|Plus1complement(58197360..58200095) NW_001867383 DNA ligase 4 LIG4 __SEG__ Chr17 {Equus caballus} MAASQTSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFKEFLDSWRKFHDALHKNQKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLL
NYRTPTGTRGDTGDFATIAYFVLKPRSLPKGSLTIQQVNDILDSVASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIVKDLKLGVSEQTVFSAFHNDAAELHNVTTD
LEKVCRQLHDPLIGLSDISITLFSAFKPMLAAIANIERIEKDMKHQSFYIETKLDGERMQMHKHGDVYQYFSRNGYDYTDQFGDSPQEGSLTPFIHNAFQPDIQICILDG
EMMAYNPNTQTFMQKGNKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGRETLRKRCEILSSIFMPIPGRIEIVQKMQAHTKQEVIDALNEAIDKREEGIMIKHPLSIYKP
DKRGEGWLKIKPEYVNGLTDELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPAGEKPSVFHTLCRVGSGYTMKELYDLGLKLAQHWKPFHKKAPPSSILCGIEKPEVYIE
PCNSVIVQIKATEIVSSDMYKTGCTLRFPRIEKIREDKEWHECLTLDDLEQLRGKASGKLASRHLYVGGDEEPQEKKRKSAPKIRKVIGIIEHLKAPNLSNINKVSNMFE
DVEFCVMSGIDNHPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIISSNKHDVVKPEWLLECFKTKSCVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFVDTD
VNHLKEVFSGIKNCSEQTPNEMASVIADLEYRYSWDHSPLSMFRHHTIYLDLYAVIRDLSTKIEGTRLAVTALELRFHGAKVVSRLAEGVSHVIIGEDYSRVAAFKAFRR
TLKRKFKILQEGWVTDSIDKCELQEENQYLV*
4 >lcl|XP_001494425.2|Plus116793334..16794275 NW_001867414 uncharacterized protein C7orf29-like LOC100062983 __SEG__ Chr4 {Equus caballus} MVFREASTAQACLSQVLPQLRYLHIFLEQVHRHFEEQSGREMGAAIRLAEGLALQLSTDCQLNELFHREEFVLATLLDPRFKGKIEAILPVGADIDHWKQVLVYKVKEIM
VSECSLPPSPSLQSPKAMPVDATLTGRIAQSPGAEGKGQKEPVQRGGSSGSLLLGQRDKSLLEQLESVGLLSSKRNGASLVTENHLASVIVKKYLRENETVGTQEDPLVY
WEKRREVWPALARLATIYLSCPATGTFSGSIFASLNSPAILEHSSPLPVETVEHLLFLKSNLENFPNYTPPPLIFPSGDLAKEEQASASDVMV*
5 >lcl|XP_001497509.2|Plus16173437..6174474 NW_001867425 lysine-specific demethylase 4D-like LOC100067390 __SEG__ Chr7 {Equus caballus} MKSKASCAQNPSCSIMIFHPTKEEFNDFDKYIAYIESQGAHRAGLAKIIPPKEWKARQTYDDINDILIATPLQQVASGRAGVFTQYHKKKKAMTVGEYRHLANSDRYQTP
PHSDFEDLERKYWKTRLYDSPIYGADISGSLFDENTEQWNLGHLGTIQDLLEQECGVVIQGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKTWYAVPPEHGQRL
ERLARQLFPGSSRSCEAFMRHKVALISPTVLKDNGIPFSRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYGKAASQCSCGEARVSFSMDAFMRILQPARY
QLWKRVQDRAVLDHT*
6 >lcl|XP_001500463.1|Plus113734101..13735303 NW_001867425 protein DDI1 homolog 1-like LOC100061526 __SEG__ Chr7 {Equus caballus} MLVTVYCVRRDLSEVTFSLQVSPDFELHNFRVLCELESGVPAEETQIIYMERLLTDDHCSLGSYGLKDGDVVVLLQKENVGPWHPGRTSSLPRIDFSGIAEPGTSSSRQQ
HHQQQRAPSAQKAHGLDSGEKMRSAQGLDSPALIRSMLLSNPHDLSLLKERNPTLAEALLSGNLETFSQVLMEQQRERALREQERLRLCSADPFDLEAQAKIEEEIRQQN
IEENMNIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIIRLVDRRWAGIAKGVGMQRIIGRIHLAQIQIEGDFLQCSFSILEEQPMDMLLGL
DMLRRHQCSIDLKKNVLVIGTTGTQTHFLPEGELPPCAKLVSGAGQEESSNKEAANTTKHSVMDSGRKKH*
7 >lcl|XP_001502303.1|Plus12278206..2279348 NW_001867370 flap endonuclease 1 FEN1 __SEG__ Chr12 {Equus caballus} MGIQGLAKLIADVAPGAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRGERRAEAEKQ
LQQAQAAGAEEEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQ
EQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAQQLFLEPEVLDPETVELKWSEPNEEELVKFMCGEKQFSEERIRSGVKRLSK
SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSAKKKAKTGAAGKFKRGK*
8 >lcl|XP_001502707.2|Plus1complement(36589891..36591129) NW_001867364 testis-specific Y-encoded-like protein 4-like LOC100072645 __SEG__ Chr10 {Equus caballus} MSGLDEGNNLPVAKTCDLGTPNHAPGHPDRNQCQGEETEATQVMADTGEGGLEPAAEGGALQDSVGYGPPLRIRVAGSRGRAATQVGQKETPPATESLEGASASVAIDNS
QENGCQRREPRSPAGEKALETCGAGGSGSQMMFGAKAKEMTTKKYAVSAATEKEGGAEEVVEEKKVIQKEKKVVGGVKEETRARAPKISNCMDSLEAIDQELSNVNAQAD
RAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMMRYMINLEVEELKHPRAGCKFKFIFQSNPYFRNEGLVKEYERRSSGRVVSLSTPIRW
HRGQDPQSHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKAELWPNPLQYYLMGEGPRRGIRDPARQPVESPRSFRFQSG*
9 >lcl|XP_001502713.1|Plus1complement(36600978..36602267) NW_001867364 testis-specific Y-encoded-like protein 1-like LOC100072651 __SEG__ Chr10 {Equus caballus} MSGLDGAERQPLPEPRRLSAPDDAPGDPEPALCPKLRGETEASQVMAETGEGSVKAAALSPPQLPEELGAPPDRAGCGQTRRLRGGGDGSCVATEAGREEAPPPTEGLAA
AAAASVATDCSLENGCGRGEPRGPGGEKALEACGAESAGSEVMAEARAEEVKPEKLPVFSVAVAEEEGVGQAMEVGENPGIEEPETVEGRGAAGQVREEAGPRALDVELR
MNPLEAIQLELDTVNAQADRAFQQLEQKFGRMRRHYLERRNYIIQNIPGFWVTAFRNHPQLSPMIRGQDAEMLRYITNLEVKELRHPRTGCKFKFFFRRNPYFRNKLIVK
EYEVRASGRVVSLSTPIIWRRGHEPQSFIRRNQDVVCSFFTWFSDHSLPESDRIAEIIKEDLWPNPLQYYLMREGARRPRRRPIREPVEIPRPFGFQSG*
10 >lcl|XP_001504971.1|Plus1complement(31772063..31774144) NW_001867427 zinc finger BED domain-containing protein 5-like isoform 1 LOC100055900 __SEG__ Chr7 {Equus caballus} MIAHLLCILSYNFNTFVILNVYSKLTMFCTTNTLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQDEDEQLQPSVSKKSEGELSRVKFMSSSNKITFSKKPKRRKY
DESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKP
CAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINGFMQR
HEIEWEKCVDVCSDASRAMDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTTLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKV
LVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINSTVDKDICSAIV
QHLRGLRSTLLKYFPVTNDNNAWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRK
RLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH*
11 >lcl|XP_001914855.1|Plus15631102..5634626 NW_001867400 zinc finger BED domain-containing protein 4 ZBED4 __SEG__ Chr28 {Equus caballus} MENNQEACPKGDDDFVSDKINFKIEEEDDEQIPDHSLERMDFKNEQEDGKQADSGDEQAEIRETSHSCKPPGKYFSADSEDDYGSLFSQYSSTLYDVAMEAVTQSLLSSR
NISSRKKSPAWKHFFISPRDSTKAICMYCMKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQENGSVSALSSLSSPSPRPPPQPADVGDLGTMLSPIKLVQKMASKIPSAD
QVTEESVSVVSSEEVSSDLSISEKHSREEALVGPPPHLSTLHYEETAENGAEKSLPLPKGASGSRRRSAVWKHFYLSPLDSSKAVCIHCMNEFSRGKNGKDLGTSCLIRH
MWRAHRSIVLQENGGGTGIPPLYSAPPTLLPALPPPEGDPNSVSSSPGKLVQESPSASSSPDRLTEDLQSHLNPRDALMEDASVLSSSDDVGEASLVSSPEKQQREGLSP
SIFESGAVFQQNKKVMKRLKSEVWHHFSLAPMDSLKAVCRHCSCVISRGKQGDVGTSCLMRHLYRRHPEVVGNQKGFLGTSLANSPYATLASAESSSSKLTDLPTMVTKN
NQVIFPVNSKKTSKLWNHFSICSTDPTKVVCLHCGRTISRGKKPSNLGTSCLLRHLQRFHSGVLKTDVPQTALPASPGIRVPLSTELSGASSFDDTSEKFYDSHPVAKKI
TSLIAEMIALDLQPYSFVDNVGFNRLLEYLKPQYSLPSPSYFSRTAIPGMYDNVKQIILSHLKEAESGVIHFTSGIWMSNQTREYLTLTAHWVTFESSVRPHCEDHHCSA
LLDVSQIDCDYSGNSIQKQLECWWEAWVTSTGLQIGITVTDNASIGKTLNEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSIARKICERVHRSPKAKEKLAELQKEYE
LPPHHLIQDVPSKWNTSFHMLERLIEQKRAVNEMSIECNFRELISCDQWEVMQSVCHALKPFDAASREMSTHMSTLSQVIPMIHILNRKIEMLFEETMGIDTMLKSLKEA
MVSRLSSTLHDPRYIFATLLDPRYKASLFSEEEAEQYKQDLIRELEMLTSTSEDTPVSNGCDPGSPSKDSVEENLWSLMAKMKRKAPREKTKVPEDMVLAYLEEEVLEHS
CDPLTYWNLKKSSWPALSTLAVRFLGCPPSIVPSEKLFNTPTENGSFGQSRLMMEHFEKLIFLKVNLPLIYFQY*
12 >lcl|XP_001915410.1|Plus1510172..513117 NW_001867416 zinc finger BED domain-containing protein 6-like LOC100146354 __SEG__ Chr5 {Equus caballus} MSICTLSVAVSSLSPSRRCSAFSSAGILGCVPINSNTDEEAVVEGKMVAEGMDKEARLPAKKKRKKGLRLKGKRRRKKLILAKKFGKDLASGRPVADAPALLASTTPEQD
EDSLFESNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTSTLQRHLQARHSPHWTRANKFGVAGGEEDFPLDVPLSPSSAGSSGSFEYIP
TDPLDDNRMGKKGDKSVSDALRAERGRFLIKSNIVKHALIPGTRAKTSAVWNFFYTDPQHISRAVCNICKRSVSRGRPGSHLGTSTLQRHLQATHPIHWAVANKDSGAVG
NGLDEPETERSDLLSDALHGDKSAGSRDLTAEDLSDCNSDEPPVLEVENRRCESPSPVAEQDTVMPAQERETTYCENSISSQISQAIIQMIVEDMHPYNYFSTPAFQRFM
QIVAPDYRLPSETYFFTKAVPQLYDWVREKIFLTLENVQSQKIHLTVDIWTHDPFTDYFVVTVHWVSLETVPSSNNGRIPNFRKWAVLCVTGLAKDCLITNILQELNDQI
GLWLSPNFLIPSFIVSDNSSNVVHAIKDGGFTHVPCFLHCLNIVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHQLPWKNLKQDETGHWISTFYMLKW
LLEHCYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQKVSVKTTGLNQVLPLIHHLLLSLQKLREDFQVRGITQALNLVDSLSLKLETDTLLSAMLKSKPCILA
ALLDPCFKNSLEDFFPQGADLETYKQILAEEVCSYMESSPEVCHVTTSEASGSSAVVGVDSFTSSVRDGTCSSGSLDSSAAHSVAIGGKSFMFPSAIAVVDEYFKEKCPE
ISGGDDPLIYWQRKVSMWPALTQVAIQYLSCPMCSWQSECIFTANSHFHPKQIMSLDFDNIEQLMFLKMNLENVNYDYSALVLRWDPENEVVQSNEKEIVS*
13 >lcl|XP_003364737.1|Plus1complement(71105373..71107343) NW_001867411 putative protein FAM200B-like LOC100068984 __SEG__ Chr3 {Equus caballus} MDHFVFKRKRINEVKYAEACSSSTVGSGSVNSDSIEKNIDSNLQTSTLFEPHFKKKKVSARRYNEDYLKYGFIKCEKPFEKDRPQCVICNNILANESLKPSKLKRHLETQ
HAELIDKPLEYFQRKKKDVKLSTQFLSSTTVSEKALLSSYLVAYRVAKEKMAHTAAEKIILPACLDMVRTIFDDKSADKLKTIPSDNTISLRICTIAEHLETMLITRLQS
GVDFAIQLDESTDIGSCMTLLVYVRYVWQDDFMEDFLCCLNLTSHLSGLNIFTELEKCIVGQYKLNWKNCKGITSDGTANITGKHSRVVKKLLEVTNNGAVWNHCFIHRE
ALASREIPQNLMEVLKNAVKVVNFIKGSSLNSRLLEIFCSEIGTNHAHLLYHTKVRWLSHGKILSRVYEFRNEIHIFLIEKKSHLASIFEDDIWVTKLAYLTDIFGILNE
LSLKLQGKSSDIFEHVERIQGFRKTLLLWEARLKSNHPSYYMFPRFCNILTRILLMKTFERNKVRDLLHLTSLSQTFNHFFPEEKFETLRGNCWVKDPFAFRNPESIVEL
NLVPEEENELLQLSSSYTLKNDYETLSLSAFWIKIKEDFPLLSRKSVLLLLPFTTTSLCELGFSVLTKLKTKERNGLNGTADMRVALSSCVPDWNELINRQAHPSH*